• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HHEX Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6185456

This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation.… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HHEX, Monoclonal Antibody
Full Product Name
HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (PE)
Product Gene Name
anti-HHEX antibody
Product Synonym Names
Hematopoietically Expressed Homeobox; HEX; HMPH; HOX11L-PEN; PRH; PRHX
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4.0e+9
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified
Specificity
Recognizes HHEX.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
32 kDa (293aa), confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
OMIM
604420
3D Structure
ModBase 3D Structure for Q03014
Immunogen
HHEX (NP_002720, 133aa-237aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCS
Conjugate
PE

Product Categories/Family for anti-HHEX antibody

Antibodies; Transcription Factors; Homeobox (HOX)
Applications Tested/Suitable for anti-HHEX antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-HHEX antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-HHEX antibody

HHEX monoclonal antibody (M10), clone 4E9 Western Blot analysis of HHEX expression in K-562 (Cat # L009V1).
Mouse Anti-HHEX Monoclonal Antibody – Cat# MBS6185456

Western Blot (WB) of anti-HHEX antibody

Western Blot analysis of HHEX expression in transfected 293T cell line by HHEX monoclonal antibody (M10), clone 4E9.

Lane 1: HHEX transfected lysate (30.02 KDa).
Lane 2: Non-transfected lysate.
Mouse Anti-HHEX Monoclonal Antibody, Western Blot (WB) – Cat# MBS6185456

Other Notes

Small volumes of anti-HHEX antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HHEX purchase

MBS6185456 is an antibody targeting HHEX. Also known as HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (PE). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for HHEX. It may not necessarily be applicable to this product.

NCBI GI #
4506049
NCBI GeneID
3087
NCBI Accession #
NP_002720
UniProt Primary Accession #
Q03014
UniProt Secondary Accession #
Q96CE9; B1AQ17
UniProt Related Accession #
Q03014
GenBank Nucleotide #
NM_002729.4
NCBI Official Full Name
hematopoietically-expressed homeobox protein HHEX
NCBI Official Synonym Full Names
hematopoietically expressed homeobox
NCBI Official Symbol
HHEX
NCBI Official Synonym Symbols
HEX; PRH; HMPH; PRHX; HOX11L-PEN
UniProt Protein Name
Hematopoietically-expressed homeobox protein HHEX
UniProt Synonym Protein Names
Homeobox protein PRH
Protein Family
Hematopoietically-expressed homeobox protein
UniProt Gene Name
HHEX
UniProt Synonym Gene Names
HEX; PRH; PRHX; Homeobox protein HEX
UniProt Entry Name
HHEX_HUMAN
NCBI Protein Information
hematopoietically-expressed homeobox protein HHEX

UniProt Comments for HHEX

HHEX: Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; protein homodimerization activity; TATA-binding protein binding; sequence-specific DNA binding; eukaryotic initiation factor 4E binding; chromatin binding; transcription factor binding; DNA bending activity

Biological Process: response to peptide hormone stimulus; negative regulation of transcription from RNA polymerase II promoter; anterior/posterior pattern formation; poly(A)+ mRNA export from nucleus; pancreas development; thyroid gland development; response to wounding; cell differentiation; vasculogenesis; positive regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway; negative regulation of vascular endothelial growth factor receptor signaling pathway; transcription, DNA-dependent; in utero embryonic development; multicellular organism growth; negative regulation of cyclin-dependent protein kinase activity; forebrain morphogenesis; interkinetic nuclear migration; regulation of cell proliferation; cell proliferation; negative regulation of angiogenesis; mRNA export from nucleus; B cell differentiation; myeloid leukocyte differentiation; embryonic heart tube development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; endoderm development
Show more

Research Articles on HHEX

1. Two differentiation-related genes, HHEX and HLX, are promoters of early phase reprogramming toward pluripotency.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HHEX antibody

 Reference Product  PubMed Publications
 CDKAL1 antibody  >91 publications with HHEX and CDKAL1
 SLC30A8 antibody  >82 publications with HHEX and SLC30A8
 TCF7L2 antibody  >80 publications with HHEX and TCF7L2
 IGF2BP2 antibody  >71 publications with HHEX and IGF2BP2
 FTO antibody  >42 publications with HHEX and FTO
 KIF11 antibody  >13 publications with HHEX and KIF11
 GATA6 antibody  >4 publications with HHEX and GATA6
 PDX1 antibody  >4 publications with HHEX and PDX1
 GATA2 antibody  >2 publications with HHEX and GATA2

Pathways associated with anti-HHEX antibody

 Products by Pathway  Pathway Diagram
 Endoderm Differentiation Pathway antibodies  Endoderm Differentiation Pathway Diagram
 Maturity Onset Diabetes Of The Young Pathway antibodies  Maturity Onset Diabetes Of The Young Pathway Diagram
 Maturity Onset Diabetes Of The Young Pathway antibodies  Maturity Onset Diabetes Of The Young Pathway Diagram
 Transcriptional Misregulation In Cancer Pathway antibodies  Transcriptional Misregulation In Cancer Pathway Diagram
 Transcriptional Misregulation In Cancer Pathway antibodies  Transcriptional Misregulation In Cancer Pathway Diagram

Diseases associated with anti-HHEX antibody

 Disease Name  Pubmed Publications
 Diabetes Mellitus, Type 2 Antibodies  >118 publications with HHEX and Diabetes Mellitus, Type 2
 Kidney Diseases Antibodies  >9 publications with HHEX and Kidney Diseases
 Liver Diseases Antibodies  >8 publications with HHEX and Liver Diseases
 Heart Diseases Antibodies  >8 publications with HHEX and Heart Diseases
 Brain Diseases Antibodies  >8 publications with HHEX and Brain Diseases
 Liver Neoplasms Antibodies  >6 publications with HHEX and Liver Neoplasms
 Abnormalities, Multiple Antibodies  >5 publications with HHEX and Abnormalities, Multiple
 Disease Models, Animal Antibodies  >4 publications with HHEX and Disease Models, Animal
 Breast Neoplasms Antibodies  >4 publications with HHEX and Breast Neoplasms
 Inflammation Antibodies  >3 publications with HHEX and Inflammation

Organs/Tissues associated with anti-HHEX antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >66 publications with HHEX and Blood
 Liver Antibodies  >54 publications with HHEX and Liver
 Pancreas Antibodies  >39 publications with HHEX and Pancreas
 Thyroid Antibodies  >35 publications with HHEX and Thyroid
 Vascular Antibodies  >24 publications with HHEX and Vascular
 Bone Antibodies  >22 publications with HHEX and Bone
 Heart Antibodies  >17 publications with HHEX and Heart
 Lung Antibodies  >10 publications with HHEX and Lung
 Muscle Antibodies  >10 publications with HHEX and Muscle
 Brain Antibodies  >10 publications with HHEX and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000