Mouse Anti-MDH2 Monoclonal Antibody – Cat# MBS6239364

MDH2 Antibody – Mouse Monoclonal

Name: MDH2 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6239364
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6239364

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MDH2, Monoclonal Antibody

Full Product Name

MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial), M-MDH, MDH, MGC:3559, MOR1) (MaxLight 750)

Product Gene Name

anti-MDH2 antibody

Product Synonym Names

Malate Dehydrogenase 2; NAD (Mitochondrial); M-MDH; MDH; MGC:3559; MOR1

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2A7

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

Purity/Purification

Purified

Specificity

Recognizes MDH2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

35.2 kDa (335aa), confirmed by MALDI-TOF

OMIM

154100

3D Structure

ModBase 3D Structure for P40926

Immunogen

MDH2 (NP_005909, 134aa-246aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

EAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGS

Conjugate

MaxLight750

Product Categories/Family for anti-MDH2 antibody

Antibodies; Enzymes; Dehydrogenase

Applications Tested/Suitable for anti-MDH2 antibody

FLISA

Application Notes for anti-MDH2 antibody

Applications are based on unconjugated antibody.

Product References and Citations for anti-MDH2 antibody

1. Metabolomics-driven approach for the improvement of Chinese hamster ovary cell growth: overexpression of malate dehydrogenase II.Chong WP, Reddy SG, Yusufi FN, Lee DY, Wong NS, Heng CK, Yap MG, Ho YS.J Biotechnol. 2010 Apr 2.

Other Notes

Small volumes of anti-MDH2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MDH2 purchase

MBS6239364 is an antibody targeting MDH2. Also known as MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial), M-MDH, MDH, MGC:3559, MOR1) (MaxLight 750). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MDH2. It may not necessarily be applicable to this product.

NCBI GI #

21735621

NCBI GeneID

4191

NCBI Accession #

NP_005909

UniProt Primary Accession #

P40926

UniProt Secondary Accession #

O43682; A8K414; B2RE78; B4DE44; E9PDB2

UniProt Related Accession #

P40926

GenBank Nucleotide #

NM_005918.3

NCBI Official Full Name

malate dehydrogenase, mitochondrial isoform 1

NCBI Official Synonym Full Names

malate dehydrogenase 2

NCBI Official Symbol

MDH2

NCBI Official Synonym Symbols

MDH; MOR1; M-MDH; EIEE51; MGC:3559

UniProt Protein Name

Malate dehydrogenase, mitochondrial

Protein Family

Malate dehydrogenase

UniProt Gene Name

MDH2

UniProt Entry Name

MDHM_HUMAN

NCBI Protein Information

malate dehydrogenase, mitochondrial

NCBI Summary for MDH2

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

UniProt Comments for MDH2

MDH2: mitochondrial malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. May play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Protein type: Mitochondrial; Carbohydrate Metabolism - pyruvate; Carbohydrate Metabolism - glyoxylate and dicarboxylate; EC 1.1.1.37; Carbohydrate Metabolism - citrate (TCA) cycle; Oxidoreductase

Chromosomal Location of Human Ortholog: 7cen-q22

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; mitochondrial inner membrane; plasma membrane; nucleus

Molecular Function: protein self-association; L-malate dehydrogenase activity; malate dehydrogenase (NADP+) activity

Biological Process: cellular metabolic process; malate metabolic process; oxaloacetate metabolic process; NADH metabolic process; tricarboxylic acid cycle; carbohydrate metabolic process; glucose metabolic process; cellular carbohydrate metabolic process; pathogenesis; internal protein amino acid acetylation; gluconeogenesis

Research Articles on MDH2

1. loss-of-function mutations in MDH2 are also associated with severe neurological clinical presentations in children

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MDH2 antibody

Reference Product	PubMed Publications
PCK1 antibody	>4 publications with MDH2 and PCK1
GOT2 antibody	>4 publications with MDH2 and GOT2
GOT1 antibody	>2 publications with MDH2 and GOT1
ME1 antibody	>2 publications with MDH2 and ME1

Pathways associated with anti-MDH2 antibody

Products by Pathway	Pathway Diagram
Amino Acid Metabolism Pathway antibodies	Amino Acid Metabolism Pathway Diagram
Carbon Metabolism Pathway antibodies	Carbon Metabolism Pathway Diagram
Carbon Metabolism Pathway antibodies	Carbon Metabolism Pathway Diagram
Citrate Cycle (TCA Cycle) Pathway antibodies	Citrate Cycle (TCA Cycle) Pathway Diagram
Citrate Cycle (TCA Cycle) Pathway antibodies	Citrate Cycle (TCA Cycle) Pathway Diagram
Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway antibodies	Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway Diagram
Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway antibodies	Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway Diagram
Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate => Oxaloacetate Pathway antibodies	Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate => Oxaloacetate Pathway Diagram
Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate => Oxaloacetate Pathway antibodies	Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate => Oxaloacetate Pathway Diagram
Citric Acid Cycle (TCA Cycle) Pathway antibodies	Citric Acid Cycle (TCA Cycle) Pathway Diagram

Diseases associated with anti-MDH2 antibody

Disease Name	Pubmed Publications
Fatty Liver Antibodies	>2 publications with MDH2 and Fatty Liver
Neoplasms, Experimental Antibodies	>1 publications with MDH2 and Neoplasms, Experimental
Brain Diseases Antibodies	>1 publications with MDH2 and Brain Diseases
Drug-Related Side Effects and Adverse Reactions Antibodies	>1 publications with MDH2 and Drug-Related Side Effects and Adverse Reactions
Liver Diseases Antibodies	>1 publications with MDH2 and Liver Diseases
Cardiovascular Diseases Antibodies	>1 publications with MDH2 and Cardiovascular Diseases
Poisoning Antibodies	>1 publications with MDH2 and Poisoning
Inflammation Antibodies	>1 publications with MDH2 and Inflammation
Drug-Induced Liver Injury Antibodies	>1 publications with MDH2 and Drug-Induced Liver Injury
Carcinoma Antibodies	>1 publications with MDH2 and Carcinoma

Organs/Tissues associated with anti-MDH2 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>5 publications with MDH2 and Blood
Liver Antibodies	>5 publications with MDH2 and Liver
Muscle Antibodies	>5 publications with MDH2 and Muscle
Brain Antibodies	>2 publications with MDH2 and Brain
Connective Tissue Antibodies	>1 publications with MDH2 and Connective Tissue
Heart Antibodies	>1 publications with MDH2 and Heart
Ovary Antibodies	>1 publications with MDH2 and Ovary
Eye Antibodies	>1 publications with MDH2 and Eye
Prostate Antibodies	>1 publications with MDH2 and Prostate
Adipose Tissue Antibodies	>1 publications with MDH2 and Adipose Tissue