Mouse Anti-PDE1B Monoclonal Antibody – Cat# MBS6181207

PDE1B Antibody – Mouse Monoclonal

Name: PDE1B Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6181207
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6181207

MBS6181207 is an antibody targeting PDE1B. Also known as PDE1B (Phosphodiesterase 1B, Calmodulin-Dependent, PDE1B1, PDES1B) (HRP). Host: Mouse. Mouse monoclonal antibody raised against a partial recombinant PDE1B. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PDE1B, Monoclonal Antibody

Full Product Name

PDE1B (Phosphodiesterase 1B, Calmodulin-Dependent, PDE1B1, PDES1B) (HRP)

Product Gene Name

anti-PDE1B antibody

Product Synonym Names

Phosphodiesterase 1B; Calmodulin-Dependent; PDE1B1; PDES1B

Clonality

Monoclonal

Isotype

IgG3,k

Clone Number

4F9

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified

Specificity

Recognizes PDE1B.

Preparation and Storage

May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunogen

PDE1B (AAH32226, 437aa-536aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD

Conjugate

HRP

Product Categories/Family for anti-PDE1B antibody

Antibodies; Enzymes; Phosphodiesterase

Applications Tested/Suitable for anti-PDE1B antibody

Western Blot (WB)

Application Notes for anti-PDE1B antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PDE1B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PDE1B. It may not necessarily be applicable to this product.

NCBI GI #

21594890

NCBI GeneID

5153

NCBI Accession #

AAH32226

UniProt Related Accession #

Q01064

NCBI Official Full Name

Phosphodiesterase 1B, calmodulin-dependent

NCBI Official Synonym Full Names

phosphodiesterase 1B

NCBI Official Symbol

PDE1B

NCBI Official Synonym Symbols

PDE1B1; PDES1B; HEL-S-79p

NCBI Protein Information

calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B

NCBI Summary for PDE1B

The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

Research Articles on PDE1B

1. The c.1618G>A, p.Gly540Ser substitution in CNGA3 was identified as the causative mutation for a novel form of ACHM in Awassi sheep. Gene augmentation therapy restored vision in the affected sheep. This novel mutation provides a large-animal model that is valid for most human CNGA3 ACHM patients; the majority of them carry missense rather than premature-termination mutations.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.