• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PGR Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6197207

This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene… More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PGR, Monoclonal Antibody
Full Product Name
PGR (Progesterone Receptor, NR3C3, PR) (MaxLight 405)
Product Gene Name
anti-PGR antibody
Product Synonym Names
Progesterone Receptor; NR3C3; PR
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4.0e+9
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Purity/Purification
Purified
Specificity
Recognizes PGR.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
87,747 Da
OMIM
607311
3D Structure
ModBase 3D Structure for P06401
Immunogen
PGR (NP_000917, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Conjugate
MaxLight405

Product Categories/Family for anti-PGR antibody

Antibodies; Receptors
Applications Tested/Suitable for anti-PGR antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-PGR antibody
Applications are based on unconjugated antibody.

Product References and Citations for anti-PGR antibody

1. Comparison of estrogenic responses in bone and uterus depending on the parity status in Lewis rats. Keiler AM, Bernhardt R, Scharnweber D, Jarry H, Vollmer G, Zierau O.J Steroid Biochem Mol Biol. 2012 Sep 29. pii: S0960-0760(12)00189-6. doi: 10.1016/j.jsbmb.2012.09.023.

Other Notes

Small volumes of anti-PGR antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PGR purchase

MBS6197207 is an antibody targeting PGR. Also known as PGR (Progesterone Receptor, NR3C3, PR) (MaxLight 405). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PGR. It may not necessarily be applicable to this product.

NCBI GI #
110611914
NCBI GeneID
5241
NCBI Accession #
NP_000917
UniProt Primary Accession #
P06401
UniProt Secondary Accession #
Q8TDS3; Q9UPF7; A7LQ08; A7X8B0; B4E3T0
UniProt Related Accession #
P06401
GenBank Nucleotide #
NM_000926
NCBI Official Full Name
progesterone receptor isoform B
NCBI Official Synonym Full Names
progesterone receptor
NCBI Official Symbol
PGR
NCBI Official Synonym Symbols
PR; NR3C3
UniProt Protein Name
Progesterone receptor
UniProt Synonym Protein Names
Nuclear receptor subfamily 3 group C member 3
Protein Family
Progesterone receptor
UniProt Gene Name
PGR
UniProt Synonym Gene Names
NR3C3; PR
UniProt Entry Name
PRGR_HUMAN
NCBI Protein Information
progesterone receptor; nuclear receptor subfamily 3 group C member 3

UniProt Comments for PGR

PR: a nuclear hormone receptor and transcription factor. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 11q22-q23

Cellular Component: nucleoplasm; mitochondrial outer membrane

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; enzyme binding; DNA binding; zinc ion binding; steroid hormone receptor activity; steroid binding; receptor binding

Biological Process: transcription initiation from RNA polymerase II promoter; progesterone receptor signaling pathway; cell-cell signaling; epithelial cell maturation; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; gene expression; signal transduction; ovulation from ovarian follicle; regulation of epithelial cell proliferation

Disease: Progesterone Resistance
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PGR antibody

 Reference Product  PubMed Publications
 ESR1 antibody  >89 publications with PGR and ESR1
 SRC antibody  >6 publications with PGR and SRC
 KLF9 antibody  >6 publications with PGR and KLF9
 SP1 antibody  >4 publications with PGR and SP1
 NCOA3 antibody  >3 publications with PGR and NCOA3
 RELA antibody  >2 publications with PGR and RELA
 NCOA1 antibody  >2 publications with PGR and NCOA1

Pathways associated with anti-PGR antibody

 Products by Pathway  Pathway Diagram
 Cellular Roles Of Anthrax Toxin Pathway antibodies  Cellular Roles Of Anthrax Toxin Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Generic Transcription Pathway antibodies  Generic Transcription Pathway Diagram
 Nuclear Receptor Transcription Pathway antibodies  Nuclear Receptor Transcription Pathway Diagram
 Nuclear Receptors Pathway antibodies  Nuclear Receptors Pathway Diagram
 Nuclear Signaling By ERBB4 Pathway antibodies  Nuclear Signaling By ERBB4 Pathway Diagram
 Oocyte Meiosis Pathway antibodies  Oocyte Meiosis Pathway Diagram
 Oocyte Meiosis Pathway antibodies  Oocyte Meiosis Pathway Diagram
 Ovarian Infertility Genes Pathway antibodies  Ovarian Infertility Genes Pathway Diagram
 Progesterone-mediated Oocyte Maturation Pathway antibodies  Progesterone-mediated Oocyte Maturation Pathway Diagram

Diseases associated with anti-PGR antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >1596 publications with PGR and Neoplasms
 Breast Neoplasms Antibodies  >1319 publications with PGR and Breast Neoplasms
 Carcinoma Antibodies  >611 publications with PGR and Carcinoma
 Adenocarcinoma Antibodies  >312 publications with PGR and Adenocarcinoma
 Recurrence Antibodies  >292 publications with PGR and Recurrence
 Neoplasms, Experimental Antibodies  >123 publications with PGR and Neoplasms, Experimental
 Uterine Neoplasms Antibodies  >89 publications with PGR and Uterine Neoplasms
 Endometrial Neoplasms Antibodies  >71 publications with PGR and Endometrial Neoplasms
 Mammary Neoplasms, Animal Antibodies  >68 publications with PGR and Mammary Neoplasms, Animal
 Ovarian Neoplasms Antibodies  >67 publications with PGR and Ovarian Neoplasms
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000