• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SYN1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6198147

This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in… More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SYN1, Monoclonal Antibody
Full Product Name
SYN1 (Synapsin I, SYN1a, SYN1b, SYNI) (MaxLight 405)
Product Gene Name
anti-SYN1 antibody
Product Synonym Names
Synapsin I; SYN1a; SYN1b; SYNI
Clonality
Monoclonal
Isotype
IgG
Clone Number
3F12
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Purity/Purification
Purified
Specificity
Recognizes SYN1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
300491
3D Structure
ModBase 3D Structure for P17600
Immunogen
SYN1 (NP_008881, 362aa-450aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ
Conjugate
MaxLight405

Product Categories/Family for anti-SYN1 antibody

Antibodies; Neuroscience
Applications Tested/Suitable for anti-SYN1 antibody
Western Blot (WB)
Application Notes for anti-SYN1 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SYN1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SYN1 purchase

MBS6198147 is an antibody targeting SYN1. Also known as SYN1 (Synapsin I, SYN1a, SYN1b, SYNI) (MaxLight 405). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SYN1. It may not necessarily be applicable to this product.

NCBI GI #
19924099
NCBI GeneID
6853
NCBI Accession #
NP_008881
UniProt Primary Accession #
P17600
UniProt Related Accession #
P17600
GenBank Nucleotide #
NP_008881.2
NCBI Official Full Name
synapsin-1 isoform Ia
NCBI Official Synonym Full Names
synapsin I
NCBI Official Symbol
SYN1
NCBI Official Synonym Symbols
SYNI; MRX50; SYN1a; SYN1b
UniProt Protein Name
Synapsin-1
UniProt Synonym Protein Names
Brain protein 4.1; Synapsin I
Protein Family
Sister chromatid cohesion 1 protein
UniProt Gene Name
SYN1
UniProt Entry Name
SYN1_HUMAN
NCBI Protein Information
synapsin-1

UniProt Comments for SYN1

SYN1: neuronal phosphoprotein which associates with the cytoplasmic surface of synaptic vesicles and binds to the cytoskeleton. May function in the regulation of neurotransmitter release and of axonogenesis and synaptogenesis. Mutations may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Two differentially spiced isoforms have been reported.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: Golgi apparatus; synaptic vesicle; dendrite; cytosol; cell junction

Molecular Function: protein binding; transporter activity; actin binding; protein kinase binding; calcium-dependent protein binding; catalytic activity; ATP binding

Biological Process: synaptic transmission; metabolic process; neurotransmitter secretion; regulation of neurotransmitter secretion

Disease: Epilepsy, X-linked, With Variable Learning Disabilities And Behavior Disorders
Show more

Research Articles on SYN1

1. A surface-based group study using novel diffusion and quantitative multiparametric imaging on 13 SYN1Q555X mutation carriers and 13 age- and sex-matched controls. Results showed significant microstructural alterations in several regions usually involved in oral and written language as well as dyslexia. The most significant changes in these regions were lowered mean diffusivity and increased fractional anisotropy.
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SYN1 antibody

 Reference Product  PubMed Publications
 SYN2 antibody  >14 publications with SYN1 and SYN2
 SYN3 antibody  >7 publications with SYN1 and SYN3
 PAK3 antibody  >1 publications with SYN1 and PAK3

Pathways associated with anti-SYN1 antibody

 Products by Pathway  Pathway Diagram
 BDNF Signaling Pathway antibodies  BDNF Signaling Pathway Diagram
 Dopamine Neurotransmitter Release Cycle Pathway antibodies  Dopamine Neurotransmitter Release Cycle Pathway Diagram
 Monoamine Transport Pathway antibodies  Monoamine Transport Pathway Diagram
 Neuronal System Pathway antibodies  Neuronal System Pathway Diagram
 Neurotransmitter Release Cycle Pathway antibodies  Neurotransmitter Release Cycle Pathway Diagram
 Serotonin Neurotransmitter Release Cycle Pathway antibodies  Serotonin Neurotransmitter Release Cycle Pathway Diagram
 Synaptic Vesicle Pathway antibodies  Synaptic Vesicle Pathway Diagram
 Transmission Across Chemical Synapses Pathway antibodies  Transmission Across Chemical Synapses Pathway Diagram

Diseases associated with anti-SYN1 antibody

 Disease Name  Pubmed Publications
 Mental Disorders Antibodies  >9 publications with SYN1 and Mental Disorders
 Neoplasms Antibodies  >6 publications with SYN1 and Neoplasms
 Brain Diseases Antibodies  >6 publications with SYN1 and Brain Diseases
 Central Nervous System Diseases Antibodies  >5 publications with SYN1 and Central Nervous System Diseases
 Neurobehavioral Manifestations Antibodies  >4 publications with SYN1 and Neurobehavioral Manifestations
 Cognition Disorders Antibodies  >3 publications with SYN1 and Cognition Disorders
 Seizures Antibodies  >3 publications with SYN1 and Seizures
 Learning Disorders Antibodies  >3 publications with SYN1 and Learning Disorders
 Necrosis Antibodies  >3 publications with SYN1 and Necrosis
 Memory Disorders Antibodies  >2 publications with SYN1 and Memory Disorders

Organs/Tissues associated with anti-SYN1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >23 publications with SYN1 and Brain
 Nerve Antibodies  >6 publications with SYN1 and Nerve
 Testis Antibodies  >3 publications with SYN1 and Testis
 Placenta Antibodies  >2 publications with SYN1 and Placenta
 Eye Antibodies  >2 publications with SYN1 and Eye
 Connective Tissue Antibodies  >1 publications with SYN1 and Connective Tissue
 Lung Antibodies  >1 publications with SYN1 and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000