• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TTF2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6176154

This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TTF2, Monoclonal Antibody
Full Product Name
TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (FITC)
Product Gene Name
anti-TTF2 antibody
Product Synonym Names
Transcription Termination Factor; RNA Polymerase II; HuF2
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B6
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified
Specificity
Recognizes TTF2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
75,128 Da
OMIM
604718
3D Structure
ModBase 3D Structure for Q9UNY4
Immunogen
TTF2 (NP_003585, 385aa-509aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQLKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFTKTTTGPPHLVPPQPLPRRGTQPVGSLELK
Conjugate
FITC

Product Categories/Family for anti-TTF2 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-TTF2 antibody
Western Blot (WB)
Application Notes for anti-TTF2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-TTF2 antibody

TTF2 monoclonal antibody (M12), clone 2B6 Western Blot analysis of TTF2 expression in MES-SA/Dx5 (Cat # L021V1).
Mouse Anti-TTF2 Monoclonal Antibody – Cat# MBS6176154

Testing Data of anti-TTF2 antibody

Detection limit for recombinant GST tagged TTF2 is approximately 1ng/ml as a capture antibody.
Mouse Anti-TTF2 Monoclonal Antibody, Testing Data – Cat# MBS6176154

Other Notes

Small volumes of anti-TTF2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TTF2 purchase

MBS6176154 is an antibody targeting TTF2. Also known as TTF2 (Transcription Termination Factor, RNA Polymerase II, HuF2) (FITC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for TTF2. It may not necessarily be applicable to this product.

NCBI GI #
40807471
NCBI GeneID
8458
NCBI Accession #
NP_003585
UniProt Primary Accession #
Q9UNY4
UniProt Secondary Accession #
O75921; Q5T2K7; Q5VVU8; Q8N6I8; A8K4Q2
UniProt Related Accession #
Q9UNY4
GenBank Nucleotide #
NM_003594
NCBI Official Full Name
transcription termination factor 2
NCBI Official Synonym Full Names
transcription termination factor, RNA polymerase II
NCBI Official Symbol
TTF2
NCBI Official Synonym Symbols
HuF2; ZGRF6
UniProt Protein Name
Transcription termination factor 2
UniProt Synonym Protein Names
Lodestar homolog; RNA polymerase II termination factor; Transcription release factor 2
Protein Family
Transcription termination factor
UniProt Gene Name
TTF2
UniProt Synonym Gene Names
F2; HuF2
UniProt Entry Name
TTF2_HUMAN
NCBI Protein Information
transcription termination factor 2; F2; RNA polymerase II termination factor; human factor 2; lodestar homolog; lodestar protein; transcription release factor 2; zinc finger, GRF-type containing 6

UniProt Comments for TTF2

TTF2: DsDNA-dependent ATPase which acts as a transcription termination factor by coupling ATP hydrolysis with removal of RNA polymerase II from the DNA template. May contribute to mitotic transcription repression. May also be involved in pre-mRNA splicing. Belongs to the SNF2/RAD54 helicase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Helicase; EC 3.6.4.-; Transcription regulation; EC 3.6.1.-; RNA splicing; DNA-binding

Chromosomal Location of Human Ortholog: 1p22

Cellular Component: spliceosome; transcription elongation factor complex; cytoplasm

Molecular Function: DNA-dependent ATPase activity; protein binding; DNA binding; zinc ion binding; ATP-dependent helicase activity; ATP binding

Biological Process: regulation of transcription, DNA-dependent; RNA splicing; mRNA processing; termination of RNA polymerase II transcription; transcription termination
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-TTF2 antibody

 Reference Product  PubMed Publications
 SUPT5H antibody  >1 publications with TTF2 and SUPT5H
 CDK9 antibody  >1 publications with TTF2 and CDK9

Pathways associated with anti-TTF2 antibody

 Products by Pathway  Pathway Diagram
 TSH Signaling Pathway antibodies  TSH Signaling Pathway Diagram
 Thyroid Hormone Synthesis Pathway antibodies  Thyroid Hormone Synthesis Pathway Diagram
 Thyroid Hormone Synthesis Pathway antibodies  Thyroid Hormone Synthesis Pathway Diagram

Diseases associated with anti-TTF2 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >3 publications with TTF2 and Nervous System Diseases
 Adenocarcinoma Antibodies  >2 publications with TTF2 and Adenocarcinoma
 Neoplasms, Experimental Antibodies  >1 publications with TTF2 and Neoplasms, Experimental
 Breast Neoplasms Antibodies  >1 publications with TTF2 and Breast Neoplasms
 Ovarian Neoplasms Antibodies  >1 publications with TTF2 and Ovarian Neoplasms
 Hypertension Antibodies  >1 publications with TTF2 and Hypertension
 Hyperplasia Antibodies  >1 publications with TTF2 and Hyperplasia
 Kidney Diseases Antibodies  >1 publications with TTF2 and Kidney Diseases
 Carcinoma, Hepatocellular Antibodies  >1 publications with TTF2 and Carcinoma, Hepatocellular

Organs/Tissues associated with anti-TTF2 antibody

 Organ/Tissue Name  Pubmed Publications
 Thyroid Antibodies  >25 publications with TTF2 and Thyroid
 Skin Antibodies  >4 publications with TTF2 and Skin
 Blood Antibodies  >4 publications with TTF2 and Blood
 Bone Antibodies  >3 publications with TTF2 and Bone
 Connective Tissue Antibodies  >2 publications with TTF2 and Connective Tissue
 Vascular Antibodies  >2 publications with TTF2 and Vascular
 Muscle Antibodies  >2 publications with TTF2 and Muscle
 Prostate Antibodies  >1 publications with TTF2 and Prostate
 Pancreas Antibodies  >1 publications with TTF2 and Pancreas
 Kidney Antibodies  >1 publications with TTF2 and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000