• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

AOC3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6199547

Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin-independent fashion. Has a monoamine oxidase activity. May play a role in… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
AOC3, Monoclonal Antibody
Full Product Name
AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (MaxLight 490)
Product Gene Name
anti-AOC3 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human AOC3.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
24,533 Da
OMIM
603735
3D Structure
ModBase 3D Structure for Q16853
Immunogen
Partial recombinant corresponding to aa351-451 from AOC3 (NP_003725) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH*
Conjugate
MaxLight490

Product Categories/Family for anti-AOC3 antibody

Antibodies; Enzymes; Oxidase
Applications Tested/Suitable for anti-AOC3 antibody
FLISA
Application Notes for anti-AOC3 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-AOC3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AOC3 purchase

MBS6199547 is an antibody targeting AOC3. Also known as AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for AOC3. It may not necessarily be applicable to this product.

NCBI GI #
4502119
NCBI GeneID
8639
NCBI Accession #
NP_003725
UniProt Primary Accession #
Q16853
UniProt Secondary Accession #
Q45F94; B2RCI5; K7ESB3; L0L8N9
UniProt Related Accession #
Q16853
GenBank Nucleotide #
NM_003734
NCBI Official Full Name
membrane primary amine oxidase isoform 1
NCBI Official Synonym Full Names
amine oxidase, copper containing 3
NCBI Official Symbol
AOC3
NCBI Official Synonym Symbols
HPAO; SSAO; VAP1; VAP-1
UniProt Protein Name
Membrane primary amine oxidase
UniProt Synonym Protein Names
Copper amine oxidase; HPAO; Semicarbazide-sensitive amine oxidase; SSAO; Vascular adhesion protein 1; VAP-1
Protein Family
Allene oxide cyclase
UniProt Gene Name
AOC3
UniProt Synonym Gene Names
VAP1; SSAO; VAP-1
UniProt Entry Name
AOC3_HUMAN
NCBI Protein Information
membrane primary amine oxidase; amine oxidase, copper containing 3 (vascular adhesion protein 1); copper amine oxidase; placenta copper monamine oxidase; semicarbazide-sensitive amine oxidase

UniProt Comments for AOC3

AOC3: Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin- independent fashion. Has a monoamine oxidase activity. May play a role in adipogenesis. Belongs to the copper/topaquinone oxidase family.

Protein type: Cell adhesion; Oxidoreductase; Amino Acid Metabolism - phenylalanine; Other Amino Acids Metabolism - beta-alanine; Membrane protein, integral; Amino Acid Metabolism - tyrosine; Amino Acid Metabolism - glycine, serine and threonine; EC 1.4.3.21

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: cell surface; microvillus; cytoplasm; plasma membrane; integral to membrane

Molecular Function: amine oxidase activity; protein binding; protein homodimerization activity; copper ion binding; protein heterodimerization activity; cation channel activity; calcium ion binding; quinone binding

Biological Process: response to antibiotic; amine metabolic process; cell adhesion; inflammatory response; cation transport
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-AOC3 antibody

 Products by Pathway  Pathway Diagram
 Glycine, Serine And Threonine Metabolism Pathway antibodies  Glycine, Serine And Threonine Metabolism Pathway Diagram
 Glycine, Serine And Threonine Metabolism Pathway antibodies  Glycine, Serine And Threonine Metabolism Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram
 Phenylalanine Metabolism Pathway antibodies  Phenylalanine Metabolism Pathway Diagram
 Phenylalanine Metabolism Pathway antibodies  Phenylalanine Metabolism Pathway Diagram
 Tyrosine Metabolism Pathway antibodies  Tyrosine Metabolism Pathway Diagram
 Tyrosine Metabolism Pathway antibodies  Tyrosine Metabolism Pathway Diagram
 Beta-Alanine Metabolism Pathway antibodies  Beta-Alanine Metabolism Pathway Diagram
 Beta-Alanine Metabolism Pathway antibodies  Beta-Alanine Metabolism Pathway Diagram
 Phenylethylamine Degradation I Pathway antibodies  Phenylethylamine Degradation I Pathway Diagram

Diseases associated with anti-AOC3 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >74 publications with AOC3 and Inflammation
 Cardiovascular Diseases Antibodies  >33 publications with AOC3 and Cardiovascular Diseases
 Atherosclerosis Antibodies  >14 publications with AOC3 and Atherosclerosis
 Necrosis Antibodies  >11 publications with AOC3 and Necrosis
 Disease Models, Animal Antibodies  >9 publications with AOC3 and Disease Models, Animal
 Liver Neoplasms Antibodies  >8 publications with AOC3 and Liver Neoplasms
 Lung Diseases Antibodies  >7 publications with AOC3 and Lung Diseases
 Hyperglycemia Antibodies  >6 publications with AOC3 and Hyperglycemia
 Liver Cirrhosis Antibodies  >5 publications with AOC3 and Liver Cirrhosis
 Hypertension Antibodies  >5 publications with AOC3 and Hypertension

Organs/Tissues associated with anti-AOC3 antibody

 Organ/Tissue Name  Pubmed Publications
 Vascular Antibodies  >167 publications with AOC3 and Vascular
 Liver Antibodies  >31 publications with AOC3 and Liver
 Kidney Antibodies  >13 publications with AOC3 and Kidney
 Brain Antibodies  >11 publications with AOC3 and Brain
 Heart Antibodies  >11 publications with AOC3 and Heart
 Adipose Tissue Antibodies  >9 publications with AOC3 and Adipose Tissue
 Lung Antibodies  >7 publications with AOC3 and Lung
 Connective Tissue Antibodies  >6 publications with AOC3 and Connective Tissue
 Umbilical Cord Antibodies  >6 publications with AOC3 and Umbilical Cord
 Eye Antibodies  >6 publications with AOC3 and Eye
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000