Mouse Anti-CD316 Monoclonal Antibody – Cat# MBS6146356

Detection limit is ~0.1ng/ml using MBS6003179 as a capture antibody.

CD316 Antibody – Mouse Monoclonal

Name: CD316 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6146356
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146356

CD316 antigen forms highly proximal, specific, and stoichiometric complexes with CD81 and CD9. It may play a key role in the diverse functions of CD81 and CD9 such as oocytes fertilisation or hepaptitis C virus function. It may regulate proliferation and… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CD316, Monoclonal Antibody

Full Product Name

CD316 (Immunoglobulin Superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (FITC)

Product Gene Name

anti-CD316 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1E4

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CD316.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunogen

Partial recombinant protein corresponding to aa220-322 from human CD316 with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PAGAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGGT

Conjugate

FITC

Product Categories/Family for anti-CD316 antibody

Antibodies; CD Markers

Applications Tested/Suitable for anti-CD316 antibody

FLISA

Application Notes for anti-CD316 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CD316 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CD316 purchase

MBS6146356 is an antibody targeting CD316. Also known as CD316 (Immunoglobulin Superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CD316. It may not necessarily be applicable to this product.

NCBI GI #

38197030

NCBI GeneID

93185

NCBI Accession #

BC004108

NCBI Related Accession #

AAH04108

UniProt Related Accession #

Q969P0

NCBI Official Full Name

Homo sapiens immunoglobulin superfamily, member 8, mRNA

NCBI Official Synonym Full Names

immunoglobulin superfamily member 8

NCBI Official Symbol

IGSF8

NCBI Official Synonym Symbols

EWI2; PGRL; CD316; EWI-2; KCT-4; CD81P3; LIR-D1

Protein Family

Immunoglobulin superfamily

NCBI Protein Information

immunoglobulin superfamily member 8

NCBI Summary for CD316

This gene encodes a member the EWI subfamily of the immunoglobulin protein superfamily. Members of this family contain a single transmembrane domain, an EWI (Glu-Trp-Ile)-motif and a variable number of immunoglobulin domains. This protein interacts with the tetraspanins CD81 and CD9 and may regulate their role in certain cellular functions including cell migration and viral infection. The encoded protein may also function as a tumor suppressor by inhibiting the proliferation of certain cancers. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]

Research Articles on CD316

1. EWI-2 negatively regulates TGF-beta signaling and its downstream events including cytostasis (in vitro and in vivo), EMT-like changes, cell migration, CD271-dependent invasion, and lung metastasis (in vivo).

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.