• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FARS2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157751

FARS2 encodes a telomere specific protein which is a component of the telomere nucleoprotein complex. This protein is present at telomeres throughout the cell cycle and functions as an inhibitor of telomerase, acting in cis to limit the elongation of… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
FARS2, Monoclonal Antibody
Full Product Name
FARS2 (FARS1, Phenylalanine-tRNA Ligase, Mitochondrial, Phenylalanyl-tRNA Synthetase) (PE)
Product Gene Name
anti-FARS2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human FARS2.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
50.6kDa (436aa), confirmed by MALDI-TOF
OMIM
611592
3D Structure
ModBase 3D Structure for O95363
Immunogen
Partial recombinant corresponding to aa351-451 from FARS2 (NP_006558) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRHMERTLSQREVRHIHQALQEAAVQLLGVEGRF
Conjugate
PE

Product Categories/Family for anti-FARS2 antibody

Antibodies; Mitochondrial Proteins
Applications Tested/Suitable for anti-FARS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-FARS2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-FARS2 antibody

Western Blot detection against Immunogen (37.22kD).
Mouse Anti-FARS2 Monoclonal Antibody – Cat# MBS6157751

Testing Data of anti-FARS2 antibody

Detection limit for recombinant GST tagged FARS2 is 0.1ng/ml as a capture antibody.
Mouse Anti-FARS2 Monoclonal Antibody, Testing Data – Cat# MBS6157751

Other Notes

Small volumes of anti-FARS2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FARS2 purchase

MBS6157751 is an antibody targeting FARS2. Also known as FARS2 (FARS1, Phenylalanine-tRNA Ligase, Mitochondrial, Phenylalanyl-tRNA Synthetase) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for FARS2. It may not necessarily be applicable to this product.

NCBI GI #
5729820
NCBI GeneID
10667
NCBI Accession #
NP_006558
UniProt Primary Accession #
O95363
UniProt Secondary Accession #
Q53F66; Q5TCS3; Q6FG29; Q9NPY7; Q9P062; B2R664
UniProt Related Accession #
O95363
GenBank Nucleotide #
NM_006567
NCBI Official Full Name
phenylalanine--tRNA ligase, mitochondrial
NCBI Official Synonym Full Names
phenylalanyl-tRNA synthetase 2, mitochondrial
NCBI Official Symbol
FARS2
NCBI Official Synonym Symbols
FARS1; PheRS; SPG77; COXPD14; HSPC320
UniProt Protein Name
Phenylalanine--tRNA ligase, mitochondrial
UniProt Synonym Protein Names
Phenylalanyl-tRNA synthetase; PheRS
UniProt Gene Name
FARS2
UniProt Synonym Gene Names
FARS1; PheRS
UniProt Entry Name
SYFM_HUMAN
NCBI Protein Information
phenylalanine--tRNA ligase, mitochondrial

NCBI Summary for FARS2

This gene encodes a protein that transfers phenylalanine to its cognate tRNA. This protein localizes to the mitochondrion and plays a role in mitochondrial protein translation. Mutations in this gene can cause combined oxidative phosphorylation deficiency 14 (Alpers encephalopathy). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Show more

UniProt Comments for FARS2

FARS2: Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins. Belongs to the class-II aminoacyl-tRNA synthetase family.

Protein type: EC 6.1.1.20; RNA-binding; Translation; Mitochondrial; Ligase

Chromosomal Location of Human Ortholog: 6p25.1

Cellular Component: mitochondrial matrix

Molecular Function: phenylalanine-tRNA ligase activity; magnesium ion binding; ATP binding; tRNA binding

Biological Process: tRNA aminoacylation for protein translation; tRNA processing; phenylalanyl-tRNA aminoacylation; gene expression

Disease: Combined Oxidative Phosphorylation Deficiency 14
Show more

Research Articles on FARS2

1. in patients with drug-resistant infantile spasm syndrome, associated with focal seizures, mild metabolic changes, and cerebral atrophy with volume loss of white matter on MRI, mutations in FARS2 should be considered.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-FARS2 antibody

 Reference Product  PubMed Publications
 AARS antibody  >1 publications with FARS2 and AARS

Pathways associated with anti-FARS2 antibody

 Products by Pathway  Pathway Diagram
 Aminoacyl-tRNA Biosynthesis Pathway antibodies  Aminoacyl-tRNA Biosynthesis Pathway Diagram
 Aminoacyl-tRNA Biosynthesis Pathway antibodies  Aminoacyl-tRNA Biosynthesis Pathway Diagram
 Aminoacyl-tRNA Biosynthesis, Eukaryotes Pathway antibodies  Aminoacyl-tRNA Biosynthesis, Eukaryotes Pathway Diagram
 Aminoacyl-tRNA Biosynthesis, Eukaryotes Pathway antibodies  Aminoacyl-tRNA Biosynthesis, Eukaryotes Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Mitochondrial TRNA Aminoacylation Pathway antibodies  Mitochondrial TRNA Aminoacylation Pathway Diagram
 TRNA Aminoacylation Pathway antibodies  TRNA Aminoacylation Pathway Diagram

Diseases associated with anti-FARS2 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >5 publications with FARS2 and Nervous System Diseases
 Memory Disorders Antibodies  >1 publications with FARS2 and Memory Disorders
 Cognition Disorders Antibodies  >1 publications with FARS2 and Cognition Disorders

Organs/Tissues associated with anti-FARS2 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >2 publications with FARS2 and Brain
 Blood Antibodies  >1 publications with FARS2 and Blood
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000