Mouse Anti-ING1 Monoclonal Antibody – Cat# MBS6204850

ING1 Antibody – Mouse Monoclonal

Name: ING1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6204850
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6204850

This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ING1, Monoclonal Antibody

Full Product Name

ING1 (Inhibitor of Growth Family, Member 1, OTTHUMP00000018703, OTTHUMP00000018704, OTTHUMP00000018705, OTTHUMP00000018706, Growth Inhibitor ING1, Growth Inhibitory Protein ING1, Inhibitor of Growth 1, Tumor suppressor ING1, p24ING1c, p33, p33ING1, p33ING

Product Gene Name

anti-ING1 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1C11

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified

Specificity

Recognizes human ING1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

~38 kDa

Chromosome Location

Chromosome: 13; NC_000013.10 (111364970..111373421). Location: 13q34

OMIM

phenotype 601566

3D Structure

ModBase 3D Structure for Q9UK53

Immunogen

Recombinant protein corresponding to aa41-140 from human ING1 with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA

Conjugate

MaxLight490

Product Categories/Family for anti-ING1 antibody

Antibodies; Tumor Suppressors

Applications Tested/Suitable for anti-ING1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-ING1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ING1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ING1 purchase

MBS6204850 is an antibody targeting ING1. Also known as ING1 (Inhibitor of Growth Family, Member 1, OTTHUMP00000018703, OTTHUMP00000018704, OTTHUMP00000018705, OTTHUMP00000018706, Growth Inhibitor ING1, Growth Inhibitory Protein ING1, Inhibitor of Growth 1, Tumor suppressor ING1, p24ING1c, p33, p33ING1, p33ING. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ING1. It may not necessarily be applicable to this product.

NCBI GI #

392050742

NCBI GeneID

3621

NCBI Accession #

NP_937862.1

UniProt Primary Accession #

Q9UK53

UniProt Secondary Accession #

O00532; O43658; Q53ZR3; Q5T9G8; Q5T9G9; Q5T9H0; Q5T9H1; Q9H007; Q9HD98; Q9HD99; Q9NS83

UniProt Related Accession #

Q9UK53

GenBank Nucleotide #

NM_198219

NCBI Official Full Name

Homo sapiens inhibitor of growth family, member 1 (ING1), transcript variant 1, mRNA

NCBI Official Synonym Full Names

inhibitor of growth family, member 1

NCBI Official Symbol

ING1

NCBI Official Synonym Symbols

p33; p47; p33ING1; p24ING1c; p33ING1b; p47ING1a

UniProt Protein Name

Inhibitor of growth protein 1

Protein Family

Inhibitor of growth protein

UniProt Gene Name

ING1

UniProt Entry Name

ING1_HUMAN

NCBI Protein Information

inhibitor of growth protein 1; growth inhibitor ING1; tumor suppressor ING1; growth inhibitory protein ING1

UniProt Comments for ING1

ING1: Cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. Implicated as a tumor suppressor gene. Defects in ING1 are a cause of head and neck squamous cell carcinomas (HNSCC); also known as squamous cell carcinoma of the head and neck. Belongs to the ING family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: nucleus

Molecular Function: protein binding; zinc ion binding; methylated histone residue binding

Biological Process: negative regulation of cell proliferation; protein import into nucleus; positive regulation of transcription, DNA-dependent; chromatin modification; negative regulation of cell growth; cell cycle

Disease: Squamous Cell Carcinoma, Head And Neck

Research Articles on ING1

1. Data identify a pathway by which ING1a induces senescence and indicate that altered endocytosis activates the Rb pathway, subsequently effecting a senescent phenotype.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-ING1 antibody

Products by Pathway	Pathway Diagram
Senescence And Autophagy Pathway antibodies	Senescence And Autophagy Pathway Diagram

Diseases associated with anti-ING1 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>120 publications with ING1 and Neoplasms
Carcinoma, Hepatocellular Antibodies	>11 publications with ING1 and Carcinoma, Hepatocellular
Liver Diseases Antibodies	>11 publications with ING1 and Liver Diseases
Disease Progression Antibodies	>8 publications with ING1 and Disease Progression
Neoplasm Metastasis Antibodies	>6 publications with ING1 and Neoplasm Metastasis
Stomach Neoplasms Antibodies	>5 publications with ING1 and Stomach Neoplasms
Gonadal Disorders Antibodies	>2 publications with ING1 and Gonadal Disorders
Ovarian Diseases Antibodies	>2 publications with ING1 and Ovarian Diseases
Abnormalities, Multiple Antibodies	>1 publications with ING1 and Abnormalities, Multiple
Uterine Cervical Neoplasms Antibodies	>1 publications with ING1 and Uterine Cervical Neoplasms

Organs/Tissues associated with anti-ING1 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>14 publications with ING1 and Brain
Skin Antibodies	>13 publications with ING1 and Skin
Liver Antibodies	>12 publications with ING1 and Liver
Lung Antibodies	>9 publications with ING1 and Lung
Blood Antibodies	>7 publications with ING1 and Blood
Stomach Antibodies	>6 publications with ING1 and Stomach
Bone Antibodies	>5 publications with ING1 and Bone
Thyroid Antibodies	>5 publications with ING1 and Thyroid
Mouth Antibodies	>4 publications with ING1 and Mouth
Lymph Node Antibodies	>4 publications with ING1 and Lymph Node