Mouse Anti-MBTPS2 Monoclonal Antibody – Cat# MBS6223136

MBTPS2 Antibody – Mouse Monoclonal

Name: MBTPS2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6223136
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6223136

This gene encodes a intramembrane zinc metalloprotease, which is essential in development. This protease functions in the signal protein activation involved in sterol control of transcription and the ER stress response. Mutations in this gene have been… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MBTPS2, Monoclonal Antibody

Full Product Name

MBTPS2 (S2P, Membrane-bound Transcription Factor Site-2 Protease, Endopeptidase S2P, Sterol Regulatory Element-binding Proteins Intramembrane Protease, FLJ32174) (MaxLight 650)

Product Gene Name

anti-MBTPS2 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1A3

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human MBTPS2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

57,444 Da

Chromosome Location

Chromosome: X; NC_000023.10 (21857656..21903541). Location: Xp22.12-p22.11

OMIM

300294

3D Structure

ModBase 3D Structure for O43462

Immunogen

Partial recombinant corresponding to aa312-419 from human MBTPS2 (NP_056968) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ASTLQQLSFPVRAYKRLDGSTECCNNHSLTDVCFSYRNNFNKRLHTCLPARKAVEATQVCRTNKDCKKSSSSSFCIIPSLETHTRLIKVKHPPQIDMLYVGHPLHLH

Conjugate

MaxLight650

Product Categories/Family for anti-MBTPS2 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-MBTPS2 antibody

FLISA, Western Blot (WB)

Application Notes for anti-MBTPS2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-MBTPS2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MBTPS2 purchase

MBS6223136 is an antibody targeting MBTPS2. Also known as MBTPS2 (S2P, Membrane-bound Transcription Factor Site-2 Protease, Endopeptidase S2P, Sterol Regulatory Element-binding Proteins Intramembrane Protease, FLJ32174) (MaxLight 650). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MBTPS2. It may not necessarily be applicable to this product.

NCBI GI #

7706693

NCBI GeneID

51360

NCBI Accession #

NP_056968.1

UniProt Primary Accession #

O43462

UniProt Secondary Accession #

Q9UM70; Q9UMD3

UniProt Related Accession #

O43462

GenBank Nucleotide #

NM_015884

NCBI Official Full Name

membrane-bound transcription factor site-2 protease

NCBI Official Synonym Full Names

membrane-bound transcription factor peptidase, site 2

NCBI Official Symbol

MBTPS2

NCBI Official Synonym Symbols

S2P; IFAP; KFSDX; BRESEK

UniProt Protein Name

Membrane-bound transcription factor site-2 protease

UniProt Synonym Protein Names

Endopeptidase S2P; Sterol regulatory element-binding proteins intramembrane protease

Protein Family

Membrane-bound transcription factor site-2 protease

UniProt Gene Name

MBTPS2

UniProt Synonym Gene Names

S2P; SREBPs intramembrane protease

UniProt Entry Name

MBTP2_HUMAN

NCBI Protein Information

membrane-bound transcription factor site-2 protease; endopeptidase S2P; SREBPs intramembrane protease; membrane-bound transcription factor protease, site 2; sterol regulatory element-binding proteins intramembrane protease

UniProt Comments for MBTPS2

MBTPS2: Intramembrane proteolysis of sterol-regulatory element- binding proteins (SREBPs) within the first transmembrane segment thereby releasing the N-terminal segment with a portion of the transmembrane segment attached. Site-2 cleavage comes after site-1 cleavage which takes place in the lumenal loop. Expressed in heart, brain, placenta, lung, liver, muscle, kidney and pancreas. Belongs to the peptidase M50A family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Protease; EC 3.4.24.85

Chromosomal Location of Human Ortholog: Xp22.12-p22.11

Cellular Component: Golgi membrane; cytoplasm; integral to membrane

Molecular Function: metalloendopeptidase activity; metal ion binding

Biological Process: cholesterol metabolic process; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; membrane protein intracellular domain proteolysis; unfolded protein response; positive regulation of transcription factor activity

Disease: Ifap Syndrome With Or Without Bresheck Syndrome; Palmoplantar Keratoderma, Mutilating, With Periorificial Keratotic Plaques, X-linked; Keratosis Follicularis Spinulosa Decalvans, X-linked

Research Articles on MBTPS2

1. We demonstrate a novel association between an MBTPS2 mutation and an X-linked form of Olmsted syndrome.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-MBTPS2 antibody

Products by Pathway	Pathway Diagram
Activation Of Chaperones By ATF6-alpha Pathway antibodies	Activation Of Chaperones By ATF6-alpha Pathway Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
Metabolism Of Lipids And Lipoproteins Pathway antibodies	Metabolism Of Lipids And Lipoproteins Pathway Diagram
Metabolism Of Proteins Pathway antibodies	Metabolism Of Proteins Pathway Diagram
Protein Processing In Endoplasmic Reticulum Pathway antibodies	Protein Processing In Endoplasmic Reticulum Pathway Diagram
Protein Processing In Endoplasmic Reticulum Pathway antibodies	Protein Processing In Endoplasmic Reticulum Pathway Diagram
Regulation Of Cholesterol Biosynthesis By SREBP (SREBF) Pathway antibodies	Regulation Of Cholesterol Biosynthesis By SREBP (SREBF) Pathway Diagram
SREBP Signalling Pathway antibodies	SREBP Signalling Pathway Diagram
Unfolded Protein Response Pathway antibodies	Unfolded Protein Response Pathway Diagram

Diseases associated with anti-MBTPS2 antibody

Disease Name	Pubmed Publications
Congenital Abnormalities Antibodies	>11 publications with MBTPS2 and Congenital Abnormalities
Nervous System Diseases Antibodies	>9 publications with MBTPS2 and Nervous System Diseases
Ichthyosis follicularis atrichia photophobia syndrome Antibodies	>5 publications with MBTPS2 and Ichthyosis follicularis atrichia photophobia syndrome
Neoplasms Antibodies	>2 publications with MBTPS2 and Neoplasms
Inflammation Antibodies	>1 publications with MBTPS2 and Inflammation
Eye Abnormalities Antibodies	>1 publications with MBTPS2 and Eye Abnormalities
Genital Diseases, Male Antibodies	>1 publications with MBTPS2 and Genital Diseases, Male
Prostatic Diseases Antibodies	>1 publications with MBTPS2 and Prostatic Diseases
Prostatic Neoplasms Antibodies	>1 publications with MBTPS2 and Prostatic Neoplasms
Drug Toxicity Antibodies	>1 publications with MBTPS2 and Drug Toxicity

Organs/Tissues associated with anti-MBTPS2 antibody

Organ/Tissue Name	Pubmed Publications
Skin Antibodies	>4 publications with MBTPS2 and Skin
Muscle Antibodies	>3 publications with MBTPS2 and Muscle
Blood Antibodies	>3 publications with MBTPS2 and Blood
Kidney Antibodies	>3 publications with MBTPS2 and Kidney
Eye Antibodies	>2 publications with MBTPS2 and Eye
Brain Antibodies	>2 publications with MBTPS2 and Brain
Lung Antibodies	>1 publications with MBTPS2 and Lung
Mammary Gland Antibodies	>1 publications with MBTPS2 and Mammary Gland
Embryonic Tissue Antibodies	>1 publications with MBTPS2 and Embryonic Tissue
Prostate Antibodies	>1 publications with MBTPS2 and Prostate