Mouse Anti-MESP2 Monoclonal Antibody – Cat# MBS6132290

MESP2 Antibody – Mouse Monoclonal

Name: MESP2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6132290
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6132290

Transcription factor with important role in somitogenesis. Defines the rostrocaudal patterning of the somite by participating in distinct Notch pathways. Regulates also the FGF signaling pathway. Specifies the rostral half of the somites. Generates… More details

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MESP2, Monoclonal Antibody

Full Product Name

MESP2 (Mesoderm Posterior Protein 2, Class C Basic Helix-loop-helix Protein 6, bHLHc6, BHLHC6, SCDO2) (AP)

Product Gene Name

anti-MESP2 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1C8

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human MESP2.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

3D Structure

ModBase 3D Structure for NM_001039958

Immunogen

Recombinant protein corresponding to aa2-125 from human MESP2 (XP_085261) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL

Conjugate

Product Categories/Family for anti-MESP2 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-MESP2 antibody

ELISA (EIA)

Application Notes for anti-MESP2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-MESP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MESP2 purchase

MBS6132290 is an antibody targeting MESP2. Also known as MESP2 (Mesoderm Posterior Protein 2, Class C Basic Helix-loop-helix Protein 6, bHLHc6, BHLHC6, SCDO2) (AP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MESP2. It may not necessarily be applicable to this product.

NCBI GI #

89038660

NCBI GeneID

145873

NCBI Accession #

XM_085261

NCBI Related Accession #

XP_085261

UniProt Primary Accession #

NM_001039958

UniProt Related Accession #

Q0VG99

NCBI Official Synonym Full Names

mesoderm posterior bHLH transcription factor 2

NCBI Official Symbol

MESP2

NCBI Official Synonym Symbols

SCDO2; bHLHc6

Protein Family

Mesoderm posterior protein

NCBI Protein Information

mesoderm posterior protein 2

NCBI Summary for MESP2

This gene encodes a member of the bHLH family of transcription factors and plays a key role in defining the rostrocaudal patterning of somites via interactions with multiple Notch signaling pathways. This gene is expressed in the anterior presomitic mesoderm and is downregulated immediately after the formation of segmented somites. This gene also plays a role in the formation of epithelial somitic mesoderm and cardiac mesoderm. Mutations in the MESP2 gene cause autosomal recessive spondylocostal dystosis 2 (SCD02). [provided by RefSeq, Oct 2008]

Research Articles on MESP2

1. MESP2, HES7 and DUSP6 genes may not be involved in the etiopathogenesis of sporadic and non-syndromic CS in Chinese Han population.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.