• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MTMR1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6137720

Lipid phosphatase that acts on phosphatidylinositol 3-phosphate and phosphatidylinositol (3,5)-bisphosphate. More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MTMR1, Monoclonal Antibody
Full Product Name
MTMR1 (Myotubularin-related Protein 1) APC
Product Gene Name
anti-MTMR1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F10
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human MTMR1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
63,330 Da
OMIM
300171
3D Structure
ModBase 3D Structure for Q13613
Immunogen
Partial recombinant corresponding to aa39-113 from MTMR1 (NP_003819) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKD
Conjugate
APC

Product Categories/Family for anti-MTMR1 antibody

Antibodies; Protein Phosphatases
Applications Tested/Suitable for anti-MTMR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-MTMR1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-MTMR1 antibody

Western Blot analysis of MTMR1 expression in transfected 293T cell line by MTMR1 monoclonal antibody. Lane 1: MTMR1 transfected lysate (39.8kD). Lane 2: Non-transfected lysate.
Mouse Anti-MTMR1 Monoclonal Antibody – Cat# MBS6137720

Testing Data of anti-MTMR1 antibody

Detection limit for recombinant GST tagged MTMR1 is 0.3ng/ml as a capture antibody.
Mouse Anti-MTMR1 Monoclonal Antibody, Testing Data – Cat# MBS6137720

Other Notes

Small volumes of anti-MTMR1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MTMR1 purchase

MBS6137720 is an antibody targeting MTMR1. Also known as MTMR1 (Myotubularin-related Protein 1) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MTMR1. It may not necessarily be applicable to this product.

NCBI GI #
28872761
NCBI GeneID
8776
NCBI Accession #
NP_003819.1
UniProt Primary Accession #
Q13613
UniProt Secondary Accession #
Q9UBX6; Q9UEM0; Q9UQD5; A0A024RC07
UniProt Related Accession #
Q13613
GenBank Nucleotide #
NM_003828
NCBI Official Full Name
myotubularin-related protein 1
NCBI Official Synonym Full Names
myotubularin related protein 1
NCBI Official Symbol
MTMR1
UniProt Protein Name
Myotubularin-related protein 1
UniProt Synonym Protein Names
Phosphatidylinositol-3-phosphate phosphatase
UniProt Gene Name
MTMR1
UniProt Entry Name
MTMR1_HUMAN
NCBI Protein Information
myotubularin-related protein 1; phosphatidylinositol-3-phosphate phosphatase

NCBI Summary for MTMR1

This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for MTMR1

MTMR1: Lipid phosphatase that acts on phosphatidylinositol 3- phosphate and phosphatidylinositol (3,5)-bisphosphate. Belongs to the protein-tyrosine phosphatase family. Non-receptor class myotubularin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.64; Carbohydrate Metabolism - fructose and mannose; Protein phosphatase, tyrosine (non-receptor); Phosphatase, lipid; Motility/polarity/chemotaxis; Cofactor and Vitamin Metabolism - thiamine; Cofactor and Vitamin Metabolism - riboflavin

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: cytoplasm; plasma membrane; cytosol

Molecular Function: phosphatidylinositol-3-phosphatase activity; protein tyrosine phosphatase activity

Biological Process: phospholipid metabolic process; phosphatidylinositol biosynthetic process; phosphoinositide dephosphorylation
Show more

Research Articles on MTMR1

1. an aberrant MTMR1 expression and signs of altered myofiber maturation were documented in both DM1 and in DM2 muscle tissues.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-MTMR1 antibody

 Products by Pathway  Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Lipids And Lipoproteins Pathway antibodies  Metabolism Of Lipids And Lipoproteins Pathway Diagram
 PI Metabolism Pathway antibodies  PI Metabolism Pathway Diagram
 Phospholipid Metabolism Pathway antibodies  Phospholipid Metabolism Pathway Diagram
 Synthesis Of PIPs At The Plasma Membrane Pathway antibodies  Synthesis Of PIPs At The Plasma Membrane Pathway Diagram

Diseases associated with anti-MTMR1 antibody

 Disease Name  Pubmed Publications
 Chromosome Aberrations Antibodies  >1 publications with MTMR1 and Chromosome Aberrations
 Lung Neoplasms Antibodies  >1 publications with MTMR1 and Lung Neoplasms
 Inflammation Antibodies  >1 publications with MTMR1 and Inflammation

Organs/Tissues associated with anti-MTMR1 antibody

 Organ/Tissue Name  Pubmed Publications
 Muscle Antibodies  >9 publications with MTMR1 and Muscle
 Heart Antibodies  >2 publications with MTMR1 and Heart
 Nerve Antibodies  >2 publications with MTMR1 and Nerve
 Thymus Antibodies  >1 publications with MTMR1 and Thymus
 Eye Antibodies  >1 publications with MTMR1 and Eye
 Embryonic Tissue Antibodies  >1 publications with MTMR1 and Embryonic Tissue
 Lung Antibodies  >1 publications with MTMR1 and Lung
 Brain Antibodies  >1 publications with MTMR1 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000