• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NPY Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6153847

Neuropeptide Y (NPY) is a 36aa residue peptide with sequence and 3-D structural homology with PYY and pancreatic polypeptide (PP). NPY serves as a neurotransmitter and is exclusively localized in neurons in the central and peripheral nervous system. NPY is… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NPY, Monoclonal Antibody
Full Product Name
NPY (Neuropeptide Y, PYY4) (HRP)
Product Gene Name
anti-NPY antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NPY.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
10,851 Da
Immunogen
Partial recombinant corresponding to aa29-98 from human NPY (AAH29497) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Conjugate
HRP

Product Categories/Family for anti-NPY antibody

Antibodies; Neuroscience
Applications Tested/Suitable for anti-NPY antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-NPY antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-NPY antibody

Western Blot detection against Immunogen (33.33kD).
Mouse Anti-NPY Monoclonal Antibody – Cat# MBS6153847

Western Blot (WB) of anti-NPY antibody

Western Blot analysis of NPY expression in transfected 293T cell line by NPY monoclonal antibody. Lane 1: NPY transfected lysate (10.9kD). Lane 2: Non-transfected lysate
Mouse Anti-NPY Monoclonal Antibody, Western Blot (WB) – Cat# MBS6153847

Other Notes

Small volumes of anti-NPY antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NPY purchase

MBS6153847 is an antibody targeting NPY. Also known as NPY (Neuropeptide Y, PYY4) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for NPY. It may not necessarily be applicable to this product.

NCBI GI #
20809582
NCBI GeneID
4852
NCBI Accession #
BC029497
NCBI Related Accession #
AAH29497
UniProt Related Accession #
P01303
NCBI Official Full Name
Homo sapiens neuropeptide Y, mRNA
NCBI Official Synonym Full Names
neuropeptide Y
NCBI Official Symbol
NPY
NCBI Official Synonym Symbols
PYY4
Protein Family
Neuropeptide
NCBI Protein Information
pro-neuropeptide Y

NCBI Summary for NPY

This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]
Show more

Research Articles on NPY

1. polymorphisms in the gene may be useful in identifying women at risk for osteoporosis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-NPY antibody

 Products by Pathway  Pathway Diagram
 Adipocytokine Signaling Pathway antibodies  Adipocytokine Signaling Pathway Diagram
 Adipocytokine Signaling Pathway antibodies  Adipocytokine Signaling Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Class A/1 (Rhodopsin-like Receptors) Pathway antibodies  Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
 Endothelin Pathway antibodies  Endothelin Pathway Diagram
 G Alpha (i) Signalling Events Pathway antibodies  G Alpha (i) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram
 Peptide Ligand-binding Receptors Pathway antibodies  Peptide Ligand-binding Receptors Pathway Diagram

Diseases associated with anti-NPY antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >596 publications with NPY and Nervous System Diseases
 Brain Diseases Antibodies  >375 publications with NPY and Brain Diseases
 Cardiovascular Diseases Antibodies  >346 publications with NPY and Cardiovascular Diseases
 Hypertension Antibodies  >240 publications with NPY and Hypertension
 Anorexia Antibodies  >205 publications with NPY and Anorexia
 Pain Antibodies  >186 publications with NPY and Pain
 Epilepsy Antibodies  >185 publications with NPY and Epilepsy
 Inflammation Antibodies  >175 publications with NPY and Inflammation
 Seizures Antibodies  >157 publications with NPY and Seizures
 Substance-Related Disorders Antibodies  >133 publications with NPY and Substance-Related Disorders

Organs/Tissues associated with anti-NPY antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >4217 publications with NPY and Brain
 Nerve Antibodies  >2160 publications with NPY and Nerve
 Muscle Antibodies  >843 publications with NPY and Muscle
 Pancreas Antibodies  >185 publications with NPY and Pancreas
 Uterus Antibodies  >62 publications with NPY and Uterus
 Prostate Antibodies  >55 publications with NPY and Prostate
 Placenta Antibodies  >21 publications with NPY and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000