Mouse Anti-PAK4 Monoclonal Antibody – Cat# MBS6138052

Western Blot detection against Immunogen (35.9kD).

PAK4 Antibody – Mouse Monoclonal

Name: PAK4 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6138052
Price: 1155 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6138052

P21-activated kinases (PAKs) belong to the family of serine/threonine kinases involved in the control of various cellular processes, including the cell cycle, dynamics of the cytoskeleton, apoptosis, oncogenic transformation, and transcription. All PAK family… More details

$1155 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PAK4, Monoclonal Antibody

Full Product Name

PAK4 (Serine/Threonine-protein Kinase PAK 4, p21-activated Kinase 4, PAK-4, KIAA1142) APC

Product Gene Name

anti-PAK4 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

3F10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human PAK4.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

54,940 Da

Immunogen

Partial recombinant corresponding to aa68-157 from PAK4 (AAH02921) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD

Conjugate

APC

Product Categories/Family for anti-PAK4 antibody

Antibodies; Protein Kinases

Applications Tested/Suitable for anti-PAK4 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-PAK4 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PAK4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PAK4 purchase

MBS6138052 is an antibody targeting PAK4. Also known as PAK4 (Serine/Threonine-protein Kinase PAK 4, p21-activated Kinase 4, PAK-4, KIAA1142) APC. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PAK4. It may not necessarily be applicable to this product.

NCBI GI #

33877350

NCBI GeneID

10298

NCBI Accession #

BC002921

NCBI Related Accession #

AAH02921

UniProt Secondary Accession #

Q8N4E1; Q8NCH5; Q8NDE3; Q9BU33; Q9ULS8; B4DGG6

UniProt Related Accession #

O96013

NCBI Official Full Name

Homo sapiens p21 protein (Cdc42/Rac)-activated kinase 4, mRNA

NCBI Official Synonym Full Names

p21 (RAC1) activated kinase 4

NCBI Official Symbol

PAK4

Protein Family

Serine/threonine-protein kinase

NCBI Protein Information

serine/threonine-protein kinase PAK 4

NCBI Summary for PAK4

PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on PAK4

1. PAK4 methylation by SETD6 promotes the activation of the Wnt/beta-catenin pathway.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-PAK4 antibody

Products by Pathway	Pathway Diagram
Activation Of Rac Pathway antibodies	Activation Of Rac Pathway Diagram
Axon Guidance Pathway antibodies	Axon Guidance Pathway Diagram
Axon Guidance Pathway antibodies	Axon Guidance Pathway Diagram
Axon Guidance Pathway antibodies	Axon Guidance Pathway Diagram
CDC42 Signaling Events Pathway antibodies	CDC42 Signaling Events Pathway Diagram
Developmental Biology Pathway antibodies	Developmental Biology Pathway Diagram
ErbB Signaling Pathway antibodies	ErbB Signaling Pathway Diagram
ErbB Signaling Pathway antibodies	ErbB Signaling Pathway Diagram
ErbB Signaling Pathway antibodies	ErbB Signaling Pathway Diagram
FGF Signaling Pathway antibodies	FGF Signaling Pathway Diagram

Diseases associated with anti-PAK4 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>35 publications with PAK4 and Neoplasms
Adenocarcinoma Antibodies	>7 publications with PAK4 and Adenocarcinoma
Liver Neoplasms Antibodies	>5 publications with PAK4 and Liver Neoplasms
Liver Diseases Antibodies	>5 publications with PAK4 and Liver Diseases
Breast Neoplasms Antibodies	>5 publications with PAK4 and Breast Neoplasms
Carcinoma, Hepatocellular Antibodies	>5 publications with PAK4 and Carcinoma, Hepatocellular
Necrosis Antibodies	>4 publications with PAK4 and Necrosis
Prostatic Diseases Antibodies	>3 publications with PAK4 and Prostatic Diseases
Genital Diseases, Male Antibodies	>3 publications with PAK4 and Genital Diseases, Male
Cardiovascular Diseases Antibodies	>2 publications with PAK4 and Cardiovascular Diseases

Organs/Tissues associated with anti-PAK4 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>8 publications with PAK4 and Brain
Prostate Antibodies	>7 publications with PAK4 and Prostate
Embryonic Tissue Antibodies	>6 publications with PAK4 and Embryonic Tissue
Liver Antibodies	>6 publications with PAK4 and Liver
Vascular Antibodies	>6 publications with PAK4 and Vascular
Nerve Antibodies	>5 publications with PAK4 and Nerve
Kidney Antibodies	>4 publications with PAK4 and Kidney
Lung Antibodies	>4 publications with PAK4 and Lung
Heart Antibodies	>4 publications with PAK4 and Heart
Muscle Antibodies	>4 publications with PAK4 and Muscle