• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PPBP Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148988

PPBP, also known as chemokine (C-X-C motif) ligand 7 (CXCL7), is a platelet-derived growth factor that belongs to the alpha-chemokine family, It is a protein that is released in large amounts from platelets following their activation. It stimulates various… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PPBP, Monoclonal Antibody
Full Product Name
PPBP (Platelet Basic Protein, PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, Small-inducible Cytokine B7, CTAP3, CXCL7, SCYB7, TGB1, THBGB1) (FITC)
Product Gene Name
anti-PPBP antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PPBP.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
13,894 Da
Chromosome Location
Chromosome: 4; NC_000004.11 (74852156..74853907, complement). Location: 4q12-q13
OMIM
121010
3D Structure
ModBase 3D Structure for P02775
Immunogen
Partial recombinant corresponding to aa37-128 from human PPBP (AAH28217) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Conjugate
FITC

Product Categories/Family for anti-PPBP antibody

Antibodies; Proteins
Applications Tested/Suitable for anti-PPBP antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PPBP antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PPBP antibody

Western Blot detection against Immunogen (35.75kD).
Mouse Anti-PPBP Monoclonal Antibody – Cat# MBS6148988

Western Blot (WB) of anti-PPBP antibody

Western Blot analysis of PPBP expression in transfected 293T cell line by PPBP monoclonal antibody. Lane 1: PPBP transfected lysate (13.9kD). Lane 2: Non-transfected lysate.
Mouse Anti-PPBP Monoclonal Antibody, Western Blot (WB) – Cat# MBS6148988

Testing Data of anti-PPBP antibody

Detection limit for recombinant GST tagged PPBP is ~0.03ng/ml as a capture antibody.
Mouse Anti-PPBP Monoclonal Antibody, Testing Data – Cat# MBS6148988

Western Blot (WB) of anti-PPBP antibody

Western blot analysis of PPBP over-expressed 293 cell line, cotransfected with PPBP Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PPBP monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-PPBP Monoclonal Antibody, Western Blot (WB) – Cat# MBS6148988

Other Notes

Small volumes of anti-PPBP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PPBP purchase

MBS6148988 is an antibody targeting PPBP. Also known as PPBP (Platelet Basic Protein, PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, Small-inducible Cytokine B7, CTAP3, CXCL7, SCYB7, TGB1, THBGB1) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PPBP. It may not necessarily be applicable to this product.

NCBI GI #
20381376
NCBI GeneID
5473
NCBI Accession #
BC028217
NCBI Related Accession #
AAH28217
UniProt Primary Accession #
P02775
UniProt Secondary Accession #
Q6IBJ8; B2R5F3
UniProt Related Accession #
P02775; AAB46877
NCBI Official Full Name
Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), mRNA
NCBI Official Synonym Full Names
pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
NCBI Official Symbol
PPBP
NCBI Official Synonym Symbols
PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III
UniProt Protein Name
Platelet basic protein
UniProt Synonym Protein Names
C-X-C motif chemokine 7; Leukocyte-derived growth factor; LDGF; Macrophage-derived growth factor; MDGF; Small-inducible cytokine B7Cleaved into the following 10 chains:Connective tissue-activating peptide III; CTAP-III; Alternative name(s):; LA-PF4; Low-affinity platelet factor IV
Protein Family
Platelet basic protein
UniProt Gene Name
PPBP
UniProt Synonym Gene Names
CTAP3; CXCL7; SCYB7; TGB1; THBGB1; PBP; LDGF; MDGF; CTAP-III; CTAP-III(1-81); Beta-TG; NAP-2(74); NAP-2(73); NAP-2; NAP-2(1-66); NAP-2(1-63)
UniProt Entry Name
CXCL7_HUMAN
NCBI Protein Information
platelet basic protein; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity

UniProt Comments for PPBP

PPBP: LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Chemokine; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q12-q13

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; chemokine activity; CXCR chemokine receptor binding; glucose transmembrane transporter activity

Biological Process: platelet activation; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; glucose transport; leukocyte migration during inflammatory response; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; platelet degranulation; positive regulation of cell division; defense response to bacterium; immune response; inflammatory response; blood coagulation
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PPBP antibody

 Reference Product  PubMed Publications
 CXCR2 antibody  >10 publications with PPBP and CXCR2
 CCL5 antibody  >5 publications with PPBP and CCL5
 CXCR1 antibody  >5 publications with PPBP and CXCR1
 PLG antibody  >1 publications with PPBP and PLG
 ALB antibody  >1 publications with PPBP and ALB

Pathways associated with anti-PPBP antibody

 Products by Pathway  Pathway Diagram
 Chemokine Receptors Bind Chemokines Pathway antibodies  Chemokine Receptors Bind Chemokines Pathway Diagram
 Chemokine Signaling Pathway antibodies  Chemokine Signaling Pathway Diagram
 Chemokine Signaling Pathway antibodies  Chemokine Signaling Pathway Diagram
 Class A/1 (Rhodopsin-like Receptors) Pathway antibodies  Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 G Alpha (i) Signalling Events Pathway antibodies  G Alpha (i) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram
 Hemostasis Pathway antibodies  Hemostasis Pathway Diagram

Diseases associated with anti-PPBP antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >35 publications with PPBP and Inflammation
 Cardiovascular Diseases Antibodies  >25 publications with PPBP and Cardiovascular Diseases
 Heart Diseases Antibodies  >11 publications with PPBP and Heart Diseases
 Neoplasms Antibodies  >9 publications with PPBP and Neoplasms
 Ischemia Antibodies  >9 publications with PPBP and Ischemia
 Necrosis Antibodies  >6 publications with PPBP and Necrosis
 Lung Diseases Antibodies  >6 publications with PPBP and Lung Diseases
 Immune System Diseases Antibodies  >5 publications with PPBP and Immune System Diseases
 Atherosclerosis Antibodies  >4 publications with PPBP and Atherosclerosis
 Drug Toxicity Antibodies  >3 publications with PPBP and Drug Toxicity

Organs/Tissues associated with anti-PPBP antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >109 publications with PPBP and Blood
 Connective Tissue Antibodies  >77 publications with PPBP and Connective Tissue
 Lung Antibodies  >8 publications with PPBP and Lung
 Heart Antibodies  >4 publications with PPBP and Heart
 Bone Marrow Antibodies  >4 publications with PPBP and Bone Marrow
 Intestine Antibodies  >3 publications with PPBP and Intestine
 Prostate Antibodies  >2 publications with PPBP and Prostate
 Liver Antibodies  >2 publications with PPBP and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000