• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SEC13 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6154862

Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SEC13, Monoclonal Antibody
Full Product Name
SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (HRP)
Product Gene Name
anti-SEC13 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SEC13.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
600152
3D Structure
ModBase 3D Structure for P55735
Immunogen
Partial recombinant corresponding to aa226-325 from human SEC13 (NP_109598) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE*
Conjugate
HRP

Product Categories/Family for anti-SEC13 antibody

Antibodies; Transport Proteins
Applications Tested/Suitable for anti-SEC13 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes for anti-SEC13 antibody
Applications are based on unconjugated antibody.

Testing Data of anti-SEC13 antibody

mmunoprecipitation of SEC13 transfected lysate using SEC13 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SEC13 rabbit polyclonal antibody.
Mouse Anti-SEC13 Monoclonal Antibody – Cat# MBS6154862

Testing Data of anti-SEC13 antibody

Detection limit for recombinant GST tagged SEC13 is 0.03ng/ml as a capture antibody.
Mouse Anti-SEC13 Monoclonal Antibody, Testing Data – Cat# MBS6154862

Other Notes

Small volumes of anti-SEC13 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SEC13 purchase

MBS6154862 is an antibody targeting SEC13. Also known as SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SEC13. It may not necessarily be applicable to this product.

NCBI GI #
34335136
NCBI GeneID
6396
NCBI Accession #
NP_109598
UniProt Primary Accession #
P55735
UniProt Related Accession #
P55735
GenBank Nucleotide #
NM_030673
NCBI Official Full Name
protein SEC13 homolog isoform 4
NCBI Official Synonym Full Names
SEC13 homolog, nuclear pore and COPII coat complex component
NCBI Official Symbol
SEC13
NCBI Official Synonym Symbols
SEC13R; npp-20; SEC13L1; D3S1231E
UniProt Protein Name
Protein SEC13 homolog
UniProt Synonym Protein Names
SEC13-like protein 1; SEC13-related protein
Protein Family
Protein transport protein
UniProt Gene Name
SEC13
UniProt Synonym Gene Names
D3S1231E; SEC13L1; SEC13R
UniProt Entry Name
SEC13_HUMAN
NCBI Protein Information
protein SEC13 homolog

NCBI Summary for SEC13

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2008]
Show more

UniProt Comments for SEC13

SEC13: Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles. Belongs to the WD repeat SEC13 family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p25-p24

Cellular Component: kinetochore; Golgi membrane; endoplasmic reticulum membrane; nuclear envelope; cytosol

Molecular Function: protein binding

Biological Process: COPII coating of Golgi vesicle; intracellular protein transport; antigen processing and presentation of peptide antigen via MHC class I; ER to Golgi vesicle-mediated transport; mRNA transport; cellular protein metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class II; protein amino acid N-linked glycosylation via asparagine; mitotic cell cycle; post-translational protein modification
Show more

Research Articles on SEC13

1. TRAPPC12, but not TRAPPC8, bound to Sec13/Sec31A tetramer but each Sec protein alone could not interact with TRAPPC12.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000