Mouse Anti-SLC19A2 Monoclonal Antibody – Cat# MBS6224675

SLC19A2 Antibody – Mouse Monoclonal

Name: SLC19A2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6224675
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6224675

MaxLight650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor647, DyLight649, Cy5 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SLC19A2, Monoclonal Antibody

Full Product Name

SLC19A2 (Solute Carrier Family 19 Member 2, Thiamine Transporter 1, THT1, ThTr1, ThTr-1, Thiamine Carrier 1, TC1, THMD1, TRMA) (MaxLight 650)

Product Gene Name

anti-SLC19A2 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

5B10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human SLC19A2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

Partial recombinant corresponding to aa209-285 from SLC19A2 (NP_008927.1) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND

Conjugate

MaxLight650

Product Categories/Family for anti-SLC19A2 antibody

Antibodies; Transport Proteins

Applications Tested/Suitable for anti-SLC19A2 antibody

FLISA, Western Blot (WB)

Application Notes for anti-SLC19A2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SLC19A2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SLC19A2 purchase

MBS6224675 is an antibody targeting SLC19A2. Also known as SLC19A2 (Solute Carrier Family 19 Member 2, Thiamine Transporter 1, THT1, ThTr1, ThTr-1, Thiamine Carrier 1, TC1, THMD1, TRMA) (MaxLight 650). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SLC19A2. It may not necessarily be applicable to this product.

NCBI GI #

27734718

NCBI GeneID

10560

NCBI Accession #

NM_006996.1

UniProt Related Accession #

O60779

GenBank Nucleotide #

NM_006996.1

NCBI Official Full Name

Homo sapiens solute carrier family 19 (thiamine transporter), member 2 (SLC19A2), mRNA

NCBI Official Synonym Full Names

solute carrier family 19 member 2

NCBI Official Symbol

SLC19A2

NCBI Official Synonym Symbols

TC1; THT1; TRMA; THMD1; THTR1

Protein Family

Thiamine transporter

NCBI Protein Information

thiamine transporter 1

NCBI Summary for SLC19A2

This gene encodes the thiamin transporter protein. Mutations in this gene cause thiamin-responsive megaloblastic anemia syndrome (TRMA), which is an autosomal recessive disorder characterized by diabetes mellitus, megaloblastic anemia and sensorineural deafness. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Research Articles on SLC19A2

1. Study demonstrate that SLC19A2 deficit causes impaired insulin secretion in conjunction with mitochondrial dysfunction, loss of protection against oxidative stress, and cell cycle arrest. These findings link SLC19A2 mutations to autosomal dominant diabetes and suggest a role of SLC19A2 in beta-cell function and survival.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.