Mouse Anti-SLC25A21 Monoclonal Antibody – Cat# MBS6133802

Detection limit for recombinant GST tagged SLC25A21 is 1ng/ml as a capture antibody.

SLC25A21 Antibody – Mouse Monoclonal

Name: SLC25A21 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6133802
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6133802

Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate. More details

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SLC25A21, Monoclonal Antibody

Full Product Name

SLC25A21 (Mitochondrial 2-oxodicarboxylate Carrier, Solute Carrier Family 25 Member 21, ODC) (AP)

Product Gene Name

anti-SLC25A21 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2C9

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human SLC25A21.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

33,117 Da

OMIM

607571

3D Structure

ModBase 3D Structure for Q9BQT8

Immunogen

Partial recombinant corresponding to aa36-100 from human SLC25A21 (NP_085134) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

VVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKK

Conjugate

Product Categories/Family for anti-SLC25A21 antibody

Antibodies; Ion Channel

Applications Tested/Suitable for anti-SLC25A21 antibody

ELISA (EIA)

Application Notes for anti-SLC25A21 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SLC25A21 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SLC25A21 purchase

MBS6133802 is an antibody targeting SLC25A21. Also known as SLC25A21 (Mitochondrial 2-oxodicarboxylate Carrier, Solute Carrier Family 25 Member 21, ODC) (AP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SLC25A21. It may not necessarily be applicable to this product.

NCBI GI #

13449279

NCBI GeneID

89874

NCBI Accession #

NP_085134.1

UniProt Primary Accession #

Q9BQT8

UniProt Secondary Accession #

Q3MJ99; A8K0L0; G3V4L5

UniProt Related Accession #

Q9BQT8

GenBank Nucleotide #

NM_030631

NCBI Official Full Name

mitochondrial 2-oxodicarboxylate carrier isoform 1

NCBI Official Synonym Full Names

solute carrier family 25 (mitochondrial oxoadipate carrier), member 21

NCBI Official Symbol

SLC25A21

NCBI Official Synonym Symbols

ODC; ODC1

UniProt Protein Name

Mitochondrial 2-oxodicarboxylate carrier

UniProt Synonym Protein Names

Solute carrier family 25 member 21

Protein Family

Mitochondrial 2-oxodicarboxylate carrier

UniProt Gene Name

SLC25A21

UniProt Synonym Gene Names

ODC

UniProt Entry Name

ODC_HUMAN

NCBI Protein Information

mitochondrial 2-oxodicarboxylate carrier; solute carrier family 25 member 21; solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21

NCBI Summary for SLC25A21

SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.[supplied by OMIM, Apr 2004]

UniProt Comments for SLC25A21

SLC25A21: Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2- oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate. Belongs to the mitochondrial carrier family.

Protein type: Membrane protein, multi-pass; Transporter; Membrane protein, integral; Mitochondrial; Transporter, SLC family

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: mitochondrial inner membrane; integral to membrane

Biological Process: lysine catabolic process; transmembrane transport

Research Articles on SLC25A21

1. Compares and contrasts all the known human SLC25A* genes and includes functional information.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SLC25A21 antibody

Reference Product	PubMed Publications
PAX9 antibody	>3 publications with SLC25A21 and PAX9
MIPOL1 antibody	>2 publications with SLC25A21 and MIPOL1
NKX2-8 antibody	>1 publications with SLC25A21 and NKX2-8

Pathways associated with anti-SLC25A21 antibody

Products by Pathway	Pathway Diagram
Lysine Catabolism Pathway antibodies	Lysine Catabolism Pathway Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
Metabolism Of Amino Acids And Derivatives Pathway antibodies	Metabolism Of Amino Acids And Derivatives Pathway Diagram

Diseases associated with anti-SLC25A21 antibody

Disease Name	Pubmed Publications
Neoplasms, Experimental Antibodies	>2 publications with SLC25A21 and Neoplasms, Experimental
Lung Neoplasms Antibodies	>2 publications with SLC25A21 and Lung Neoplasms
Hyperglycemia Antibodies	>1 publications with SLC25A21 and Hyperglycemia
Congenital Abnormalities Antibodies	>1 publications with SLC25A21 and Congenital Abnormalities
Kidney Diseases Antibodies	>1 publications with SLC25A21 and Kidney Diseases
Liver Diseases Antibodies	>1 publications with SLC25A21 and Liver Diseases
Inflammation Antibodies	>1 publications with SLC25A21 and Inflammation

Organs/Tissues associated with anti-SLC25A21 antibody

Organ/Tissue Name	Pubmed Publications
Lung Antibodies	>2 publications with SLC25A21 and Lung
Brain Antibodies	>2 publications with SLC25A21 and Brain
Liver Antibodies	>1 publications with SLC25A21 and Liver
Eye Antibodies	>1 publications with SLC25A21 and Eye
Kidney Antibodies	>1 publications with SLC25A21 and Kidney