Mouse Anti-USP4 Monoclonal Antibody – Cat# MBS6150405

USP4 Antibody – Mouse Monoclonal

Name: USP4 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6150405
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6150405

MBS6150405 is an antibody targeting USP4. Also known as USP4 (Ubiquitin-specific-processing Protease 4, Ubiquitin Carboxyl-terminal Hydrolase 4, Deubiquitinating Enzyme 4, Ubiquitin Thioesterase 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) (FITC).… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

USP4, Monoclonal Antibody

Full Product Name

USP4 (Ubiquitin-specific-processing Protease 4, Ubiquitin Carboxyl-terminal Hydrolase 4, Deubiquitinating Enzyme 4, Ubiquitin Thioesterase 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) (FITC)

Product Gene Name

anti-USP4 antibody

Product Synonym Names

EC=3.4.19.12

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

5E12

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human USP4.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

35,661 Da

OMIM

603486

3D Structure

ModBase 3D Structure for Q13107

Immunogen

Partial recombinant corresponding to aa676-773 from human USP4 (NP_003354) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK

Conjugate

FITC

Product Categories/Family for anti-USP4 antibody

Antibodies; Ubiquitin

Applications Tested/Suitable for anti-USP4 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-USP4 antibody

ELISA: 10ng/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-USP4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for USP4. It may not necessarily be applicable to this product.

NCBI GI #

40795665

NCBI GeneID

7375

NCBI Accession #

NP_003354

UniProt Primary Accession #

Q13107

UniProt Secondary Accession #

O43452; O43453; Q08AK8; A8K6Y0; C9IY91

UniProt Related Accession #

Q13107

GenBank Nucleotide #

NM_003363

NCBI Official Full Name

ubiquitin carboxyl-terminal hydrolase 4 isoform a

NCBI Official Synonym Full Names

ubiquitin specific peptidase 4 (proto-oncogene)

NCBI Official Symbol

USP4

NCBI Official Synonym Symbols

UNP; Unph

UniProt Protein Name

Ubiquitin carboxyl-terminal hydrolase 4

UniProt Synonym Protein Names

Deubiquitinating enzyme 4; Ubiquitin thioesterase 4; Ubiquitin-specific-processing protease 4; Ubiquitous nuclear protein homolog

UniProt Gene Name

USP4

UniProt Synonym Gene Names

UNP; UNPH

UniProt Entry Name

UBP4_HUMAN

NCBI Protein Information

ubiquitin carboxyl-terminal hydrolase 4; deubiquitinating enzyme 4; ubiquitin carboxyl-terminal esterase 4; ubiquitin specific protease 4 (proto-oncogene); ubiquitin thioesterase 4; ubiquitin thiolesterase 4; ubiquitin-specific processing protease 4; ubiq

UniProt Comments for USP4

USP4: Hydrolase that deubiquitinates target proteins such as the receptor ADORA2A, PDPK1 and TRIM21. Deubiquitination of ADORA2A increases the amount of functional receptor at the cell surface. Plays a role in the regulation of quality control in the ER. Interacts with RB1 (both dephosphorylated and hypophosphorylated forms). Interacts with ADORA2A (via cytoplasmic C-terminus); the interaction is direct. Interacts with RB1, RBL1 and RBL2. Overexpressed in small cell tumors and adenocarcinomas of the lung compared to wild-type lung. Expressed in the hippocampal neurons. Belongs to the peptidase C19 family. USP4 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin-specific protease; Protease; EC 3.4.19.12; Oncoprotein; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: lysosome; cytoplasm; plasma membrane; nucleus

Molecular Function: identical protein binding; protein binding; cysteine-type endopeptidase activity; metal ion binding; ubiquitin-specific protease activity; adenosine receptor binding

Biological Process: assembly of spliceosomal tri-snRNP; proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; regulation of protein stability; negative regulation of protein ubiquitination

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-USP4 antibody

Reference Product	PubMed Publications
PRPF3 antibody	>1 publications with USP4 and PRPF3
SART3 antibody	>1 publications with USP4 and SART3

Diseases associated with anti-USP4 antibody

Disease Name	Pubmed Publications
Adenocarcinoma Antibodies	>3 publications with USP4 and Adenocarcinoma
Necrosis Antibodies	>3 publications with USP4 and Necrosis
Inflammation Antibodies	>2 publications with USP4 and Inflammation
Anemia Antibodies	>1 publications with USP4 and Anemia
Prostatic Neoplasms Antibodies	>1 publications with USP4 and Prostatic Neoplasms
Cell Transformation, Neoplastic Antibodies	>1 publications with USP4 and Cell Transformation, Neoplastic
Carcinoma, Hepatocellular Antibodies	>1 publications with USP4 and Carcinoma, Hepatocellular

Organs/Tissues associated with anti-USP4 antibody

Organ/Tissue Name	Pubmed Publications
Lung Antibodies	>2 publications with USP4 and Lung
Spleen Antibodies	>1 publications with USP4 and Spleen