• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAPKAPK3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6142822

MBS6142822 is an antibody targeting MAPKAPK3. Also known as MAPKAPK3 (Mitogen-activated Protein Kinase-activated Protein Kinase 3, MAP Kinase-activated Protein Kinase 3, MAPK-activated Protein Kinase 3, MAPKAP Kinase 3, MAPKAPK-3, Chromosome 3p Kinase, 3pK)… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAPKAPK3, Monoclonal Antibody
Full Product Name
MAPKAPK3 (Mitogen-activated Protein Kinase-activated Protein Kinase 3, MAP Kinase-activated Protein Kinase 3, MAPK-activated Protein Kinase 3, MAPKAP Kinase 3, MAPKAPK-3, Chromosome 3p Kinase, 3pK) (Biotin)
Product Gene Name
anti-MAPKAPK3 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Host
Mouse
Species Reactivity
Human, Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human MAPKAPK3. Species Crossreactivity: mouse.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
42,987 Da
Immunogen
Partial recombinant corresponding to aa272-382 from MAPKAPK3 (AAH01662) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ
Conjugate
Biotin

Product Categories/Family for anti-MAPKAPK3 antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-MAPKAPK3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-MAPKAPK3 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-MAPKAPK3 antibody

MAPKAPK3 monoclonal antibody Western Blot analysis of MAPKAPK3 expression in HeLa.
Mouse Anti-MAPKAPK3 Monoclonal Antibody – Cat# MBS6142822

Western Blot (WB) of anti-MAPKAPK3 antibody

Western Blot detection against Immunogen (38.21kD).
Mouse Anti-MAPKAPK3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6142822

Immunohistochemistry (IHC) of anti-MAPKAPK3 antibody

Immunoperoxidase of monoclonal antibody to MAPKAPK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml]
Mouse Anti-MAPKAPK3 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6142822

Testing Data of anti-MAPKAPK3 antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK13 and MAPKAPK3 HeLa cells were stained with MAPK13 rabbit purified polyclonal 1:1200 and MAPKAPK3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-MAPKAPK3 Monoclonal Antibody, Testing Data – Cat# MBS6142822

Other Notes

Small volumes of anti-MAPKAPK3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for MAPKAPK3. It may not necessarily be applicable to this product.

NCBI GI #
33876390
NCBI GeneID
7867
NCBI Accession #
BC001662
NCBI Related Accession #
AAH01662
UniProt Secondary Accession #
B5BU67
UniProt Related Accession #
Q16644
NCBI Official Full Name
Homo sapiens mitogen-activated protein kinase-activated protein kinase 3, mRNA
NCBI Official Synonym Full Names
mitogen-activated protein kinase-activated protein kinase 3
NCBI Official Symbol
MAPKAPK3
NCBI Official Synonym Symbols
3PK; MK-3; MAPKAP3; MAPKAP-K3; MAPKAPK-3
Protein Family
MAP kinase-activated protein kinase
NCBI Protein Information
MAP kinase-activated protein kinase 3

NCBI Summary for MAPKAPK3

This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]
Show more

Research Articles on MAPKAPK3

1. MK3 modulation affects BMI1-dependent and independent cell cycle check-points

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-MAPKAPK3 antibody

 Products by Pathway  Pathway Diagram
 Activated TLR4 Signalling Pathway antibodies  Activated TLR4 Signalling Pathway Diagram
 FAS Pathway And Stress Induction Of HSP Regulation antibodies  FAS Pathway And Stress Induction Of HSP Regulation Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Innate Immune System Pathway antibodies  Innate Immune System Pathway Diagram
 MAP Kinase Activation In TLR Cascade Pathway antibodies  MAP Kinase Activation In TLR Cascade Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MyD88 Cascade Initiated On Plasma Membrane Pathway antibodies  MyD88 Cascade Initiated On Plasma Membrane Pathway Diagram
 MyD88 Dependent Cascade Initiated On Endosome Pathway antibodies  MyD88 Dependent Cascade Initiated On Endosome Pathway Diagram
 MyD88-independent Cascade Pathway antibodies  MyD88-independent Cascade Pathway Diagram

Diseases associated with anti-MAPKAPK3 antibody

 Disease Name  Pubmed Publications
 Necrosis Antibodies  >8 publications with MAPKAPK3 and Necrosis
 Inflammation Antibodies  >4 publications with MAPKAPK3 and Inflammation
 Gastrointestinal Diseases Antibodies  >2 publications with MAPKAPK3 and Gastrointestinal Diseases
 Liver Diseases Antibodies  >2 publications with MAPKAPK3 and Liver Diseases
 Lung Neoplasms Antibodies  >2 publications with MAPKAPK3 and Lung Neoplasms
 Disease Models, Animal Antibodies  >2 publications with MAPKAPK3 and Disease Models, Animal
 Hepatitis Antibodies  >2 publications with MAPKAPK3 and Hepatitis
 Liver Neoplasms Antibodies  >1 publications with MAPKAPK3 and Liver Neoplasms
 Death Antibodies  >1 publications with MAPKAPK3 and Death
 Heart Diseases Antibodies  >1 publications with MAPKAPK3 and Heart Diseases

Organs/Tissues associated with anti-MAPKAPK3 antibody

 Organ/Tissue Name  Pubmed Publications
 Embryonic Tissue Antibodies  >1 publications with MAPKAPK3 and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000