Rabbit Anti-CLDN15 Polyclonal Antibody – Cat# MBS6374075

Western Blot analysis of CLDN15 expression in transfected 293T cell line by CLDN15 polyclonal antibody. Lane 1: CLDN15 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.

CLDN15 Antibody – Rabbit Polyclonal

Name: CLDN15 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6374075
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6374075

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CLDN15, Polyclonal Antibody

Full Product Name

CLDN15 (Claudin-15, Claudin 15, FLJ42715, MGC19536) (HRP)

Product Gene Name

anti-CLDN15 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CLDN15.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

3D Structure

ModBase 3D Structure for P56746

Immunogen

Full length human CLDN15, aa1-228 (NP_055158.1).

Immunogen Sequence

MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Conjugate

HRP

Note

Preservative Free

Product Categories/Family for anti-CLDN15 antibody

Antibodies; Claudin

Applications Tested/Suitable for anti-CLDN15 antibody

Western Blot (WB)

Application Notes for anti-CLDN15 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CLDN15 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CLDN15 purchase

MBS6374075 is an antibody targeting CLDN15. Also known as CLDN15 (Claudin-15, Claudin 15, FLJ42715, MGC19536) (HRP). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for CLDN15. It may not necessarily be applicable to this product.

NCBI GI #

7656981

NCBI GeneID

24146

NCBI Accession #

NP_055158.1

UniProt Primary Accession #

P56746

UniProt Related Accession #

P56746

GenBank Nucleotide #

NM_014343.1

NCBI Official Full Name

claudin-15

NCBI Official Synonym Full Names

claudin 15

NCBI Official Symbol

CLDN15

UniProt Protein Name

Claudin-15

Protein Family

Claudin

UniProt Gene Name

CLDN15

NCBI Protein Information

claudin-15

NCBI Summary for CLDN15

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2010]

UniProt Comments for CLDN15

Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members function as impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN15 forms tight junctions that mediate the paracellular transport of small monovalent cations along a concentration gradient, due to selective permeability for Na+, Li+ and K+ ions, but selects against Cl- ions. Plays an important role in paracellular Na+ transport in the intestine and in Na+ homeostasis. Required for normal Na+-dependent intestinal nutrient uptake.

Research Articles on CLDN15

1. analysis of claudin-15 tight junction paracellular architecture by molecular dynamics simulations

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CLDN15 antibody

Products by Pathway	Pathway Diagram
Cell Adhesion Molecules (CAMs) Pathway antibodies	Cell Adhesion Molecules (CAMs) Pathway Diagram
Cell Adhesion Molecules (CAMs) Pathway antibodies	Cell Adhesion Molecules (CAMs) Pathway Diagram
Cell Junction Organization Pathway antibodies	Cell Junction Organization Pathway Diagram
Cell-cell Junction Organization Pathway antibodies	Cell-cell Junction Organization Pathway Diagram
Hepatitis C Pathway antibodies	Hepatitis C Pathway Diagram
Hepatitis C Pathway antibodies	Hepatitis C Pathway Diagram
Leukocyte Transendothelial Migration Pathway antibodies	Leukocyte Transendothelial Migration Pathway Diagram
Leukocyte Transendothelial Migration Pathway antibodies	Leukocyte Transendothelial Migration Pathway Diagram
Tight Junction Pathway antibodies	Tight Junction Pathway Diagram
Tight Junction Pathway antibodies	Tight Junction Pathway Diagram

Organs/Tissues associated with anti-CLDN15 antibody

Organ/Tissue Name	Pubmed Publications
Intestine Antibodies	>2 publications with CLDN15 and Intestine
Blood Antibodies	>1 publications with CLDN15 and Blood