Rabbit Anti-FKBP5 Polyclonal Antibody – Cat# MBS6378670

Western Blot analysis of FKBP5 expression in transfected 293T cell line by FKBP5 polyclonal antibody. Lane 1: FKBP5 transfected lysate (51.2kD). Lane 2: Non-transfected lysate.

FKBP5 Antibody – Rabbit Polyclonal

Name: FKBP5 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6378670
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6378670

The protein is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506… More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

FKBP5, Polyclonal Antibody

Full Product Name

FKBP5 (FK506-binding Protein 5, Peptidyl-prolyl cis-trans Isomerase FKBP5, PPIase FKBP5, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 51kD FK506-binding Protein, 51kD FKBP, FKBP-51, 54kD Progesterone Receptor-associated Immunophilin, FKBP54, p

Product Gene Name

anti-FKBP5 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human FKBP5.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

602623

3D Structure

ModBase 3D Structure for Q13451

Immunogen

Full length human FKBP5, aa1-457 (NP_004108.1).

Immunogen Sequence

MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV

Conjugate

APC

Note

Preservative Free

Product Categories/Family for anti-FKBP5 antibody

Antibodies; Enzymes; Isomerase

Applications Tested/Suitable for anti-FKBP5 antibody

Western Blot (WB)

Application Notes for anti-FKBP5 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-FKBP5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FKBP5 purchase

MBS6378670 is an antibody targeting FKBP5. Also known as FKBP5 (FK506-binding Protein 5, Peptidyl-prolyl cis-trans Isomerase FKBP5, PPIase FKBP5, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 51kD FK506-binding Protein, 51kD FKBP, FKBP-51, 54kD Progesterone Receptor-associated Immunophilin, FKBP54, p. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for FKBP5. It may not necessarily be applicable to this product.

NCBI GI #

4758384

NCBI GeneID

2289

NCBI Accession #

NP_004108.1

UniProt Primary Accession #

Q13451

UniProt Related Accession #

Q13451

GenBank Nucleotide #

NM_004117.2

NCBI Official Full Name

peptidyl-prolyl cis-trans isomerase FKBP5 isoform 1

NCBI Official Synonym Full Names

FKBP prolyl isomerase 5

NCBI Official Symbol

FKBP5

NCBI Official Synonym Symbols

P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10

UniProt Protein Name

Peptidyl-prolyl cis-trans isomerase FKBP5

UniProt Synonym Protein Names

51 kDa FK506-binding protein; 51 kDa FKBP; FKBP-51; 54 kDa progesterone receptor-associated immunophilin; Androgen-regulated protein 6; FF1 antigen; FK506-binding protein 5; FKBP-5; FKBP54; p54; HSP90-binding immunophilin; Rotamase

Protein Family

FK506-binding protein

UniProt Gene Name

FKBP5

UniProt Synonym Gene Names

AIG6; FKBP51; PPIase FKBP5; 51 kDa FKBP; FKBP-51; FKBP-5; p54

UniProt Entry Name

FKBP5_HUMAN

NCBI Protein Information

peptidyl-prolyl cis-trans isomerase FKBP5

NCBI Summary for FKBP5

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]

UniProt Comments for FKBP5

FKBP5: Interacts with functionally mature heterooligomeric progesterone receptor complexes along with HSP90 and TEBP. Part of a heteromultimeric cytoplasmic complex with HSP90, HSP70 and steroid receptors. Dissociates from the complex when NR3C1 binds glucocorticoid. By androgen. Widely expressed, enriched in testis compared to other tissues. Inhibited by FK506 but not cyclosporin.

Protein type: EC 5.2.1.8; Isomerase; Chaperone

Chromosomal Location of Human Ortholog: 6p21.31

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; membrane

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; FK506 binding; heat shock protein binding

Biological Process: protein peptidyl-prolyl isomerization; protein folding

Disease: Major Depressive Disorder

Research Articles on FKBP5

1. A significant main effect of FKBP5 rs1360780 and PTSD and an interaction effect between genotype and PTSD status were found on mean FKBP5 DNA methylation level. The T allele of rs1360780 was associated with lower FKBP5 methylation level.The PTSD group showed significantly higher methylation than the non-PTSD group among veterans carrying the risk T allele (n = 96), while no difference was observed with the CC genotype

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.