• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HBEGF Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6451069

MBS6451069 is an antibody targeting HBEGF. Also known as HBEGF (heparin-Binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL) (AP). Reactive in Human. Host: Rabbit. Rabbit polyclonal antibody raised against a full-length human HBEGF protein. More details

$1040 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HBEGF, Polyclonal Antibody
Full Product Name
HBEGF (heparin-Binding EGF-like Growth Factor, DTR, DTS, DTSF, HEGFL) (AP)
Product Gene Name
anti-HBEGF antibody
Product Synonym Names
heparin-Binding EGF-like Growth Factor; DTR; DTS; DTSF; HEGFL
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified
Specificity
Recognizes human HBEGF.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
23,067 Da
OMIM
126150
3D Structure
ModBase 3D Structure for Q99075
Immunogen
HBEGF (NP_001936.1, 1aa-208aa) full-length human protein.
Immunogen Sequence
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
Conjugate
AP
Note
Preservative Free

Product Categories/Family for anti-HBEGF antibody

Antibodies; Growth Factors; Cytokines
Applications Tested/Suitable for anti-HBEGF antibody
Western Blot (WB)
Application Notes for anti-HBEGF antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-HBEGF antibody

Western Blot analysis of HBEGF expression in transfected 293T cell line by HBEGF MaxPab polyclonal antibody.

Lane 1: HBEGF transfected lysate(23.10 KDa).
Lane 2: Non-transfected lysate.
Rabbit Anti-HBEGF Polyclonal Antibody – Cat# MBS6451069

Western Blot (WB) of anti-HBEGF antibody

HBEGF MaxPab rabbit polyclonal antibody. Western Blot analysis of HBEGF expression in human liver.
Rabbit Anti-HBEGF Polyclonal Antibody, Western Blot (WB) – Cat# MBS6451069

Other Notes

Small volumes of anti-HBEGF antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for HBEGF. It may not necessarily be applicable to this product.

NCBI GI #
4503413
NCBI GeneID
1839
NCBI Accession #
NP_001936.1
UniProt Primary Accession #
Q99075
UniProt Secondary Accession #
B2R821
UniProt Related Accession #
Q99075
GenBank Nucleotide #
NM_001945.2
NCBI Official Full Name
proheparin-binding EGF-like growth factor
NCBI Official Synonym Full Names
heparin-binding EGF-like growth factor
NCBI Official Symbol
HBEGF
NCBI Official Synonym Symbols
DTR; DTS; DTSF; HEGFL
UniProt Protein Name
Proheparin-binding EGF-like growth factor
UniProt Synonym Protein Names
Diphtheria toxin receptor
Protein Family
Proheparin-binding EGF-like growth factor
UniProt Gene Name
HBEGF
UniProt Synonym Gene Names
DTR; DTS; HEGFL; HB-EGF; HBEGF; DT-R
UniProt Entry Name
HBEGF_HUMAN
NCBI Protein Information
proheparin-binding EGF-like growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor)

UniProt Comments for HBEGF

HBEGF: Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 5q23

Cellular Component: extracellular space; cell surface; integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: heparin binding; growth factor activity; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; positive regulation of keratinocyte migration; muscle development; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; negative regulation of elastin biosynthetic process; positive regulation of smooth muscle cell proliferation; pathogenesis; signal transduction; positive regulation of cell growth; regulation of heart contraction; positive regulation of protein kinase B signaling cascade; positive regulation of cell proliferation; innate immune response; wound healing, spreading of epidermal cells; positive regulation of cell migration
Show more

Research Articles on HBEGF

1. studies suggest disintegrin and metalloproteinase domain-containing protein 12(ADAM 12S) and heparin-binding epidermal growth factor-like growth factor(HB-EGF) are involved in cellular plasticity resulting in production of brown adipose tissue-like cells

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HBEGF antibody

 Reference Product  PubMed Publications
 EGFR antibody  >19 publications with HBEGF and EGFR
 IL8 antibody  >4 publications with HBEGF and IL8
 MMP7 antibody  >2 publications with HBEGF and MMP7
 MMP9 antibody  >1 publications with HBEGF and MMP9
 NRG2 antibody  >1 publications with HBEGF and NRG2
 CD9 antibody  >1 publications with HBEGF and CD9
 ADAM17 antibody  >1 publications with HBEGF and ADAM17
 ERBB2 antibody  >1 publications with HBEGF and ERBB2
 ERBB4 antibody  >1 publications with HBEGF and ERBB4

Pathways associated with anti-HBEGF antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Constitutive PI3K/AKT Signaling In Cancer Pathway antibodies  Constitutive PI3K/AKT Signaling In Cancer Pathway Diagram
 DAP12 Interactions Pathway antibodies  DAP12 Interactions Pathway Diagram
 DAP12 Signaling Pathway antibodies  DAP12 Signaling Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Downstream Signal Transduction Pathway antibodies  Downstream Signal Transduction Pathway Diagram
 Downstream Signaling Events Of B Cell Receptor (BCR) Pathway antibodies  Downstream Signaling Events Of B Cell Receptor (BCR) Pathway Diagram
 Downstream Signaling Of Activated FGFR Pathway antibodies  Downstream Signaling Of Activated FGFR Pathway Diagram
 EGFR Transactivation By Gastrin Pathway antibodies  EGFR Transactivation By Gastrin Pathway Diagram
 Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway antibodies  Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway Diagram

Diseases associated with anti-HBEGF antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >11 publications with HBEGF and Neoplasms
 Cardiovascular Diseases Antibodies  >10 publications with HBEGF and Cardiovascular Diseases
 Inflammation Antibodies  >7 publications with HBEGF and Inflammation
 Necrosis Antibodies  >7 publications with HBEGF and Necrosis
 Heart Diseases Antibodies  >5 publications with HBEGF and Heart Diseases
 Disease Models, Animal Antibodies  >5 publications with HBEGF and Disease Models, Animal
 Lung Diseases Antibodies  >4 publications with HBEGF and Lung Diseases
 Hypertrophy Antibodies  >3 publications with HBEGF and Hypertrophy
 Neoplasms, Experimental Antibodies  >3 publications with HBEGF and Neoplasms, Experimental
 Fibrosis Antibodies  >2 publications with HBEGF and Fibrosis

Organs/Tissues associated with anti-HBEGF antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >11 publications with HBEGF and Blood
 Placenta Antibodies  >10 publications with HBEGF and Placenta
 Muscle Antibodies  >10 publications with HBEGF and Muscle
 Lung Antibodies  >10 publications with HBEGF and Lung
 Vascular Antibodies  >9 publications with HBEGF and Vascular
 Uterus Antibodies  >6 publications with HBEGF and Uterus
 Skin Antibodies  >6 publications with HBEGF and Skin
 Bone Antibodies  >6 publications with HBEGF and Bone
 Liver Antibodies  >6 publications with HBEGF and Liver
 Embryonic Tissue Antibodies  >6 publications with HBEGF and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000