• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HSD17B3 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6381723

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with… More details

$1165 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HSD17B3, Polyclonal Antibody
Full Product Name
HSD17B3 (EDH17B3, Testosterone 17-beta-dehydrogenase 3, 17-beta-hydroxysteroid Dehydrogenase Type 3, Testicular 17-beta-hydroxysteroid Dehydrogenase) (MaxLight 550)
Product Gene Name
anti-HSD17B3 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human HSD17B3.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
34,516 Da
OMIM
264300
3D Structure
ModBase 3D Structure for P37058
Immunogen
Full length human HSD17B3, aa1-310 (NP_000188.1).
Immunogen Sequence
MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
Conjugate
MaxLight550
Note
Preservative Free

Product Categories/Family for anti-HSD17B3 antibody

Antibodies; Enzymes; Dehydrogenase
Applications Tested/Suitable for anti-HSD17B3 antibody
Western Blot (WB)
Application Notes for anti-HSD17B3 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-HSD17B3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HSD17B3 purchase

MBS6381723 is an antibody targeting HSD17B3. Also known as HSD17B3 (EDH17B3, Testosterone 17-beta-dehydrogenase 3, 17-beta-hydroxysteroid Dehydrogenase Type 3, Testicular 17-beta-hydroxysteroid Dehydrogenase) (MaxLight 550). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for HSD17B3. It may not necessarily be applicable to this product.

NCBI GI #
4557649
NCBI GeneID
3293
NCBI Accession #
NP_000188.1
UniProt Primary Accession #
P37058
UniProt Related Accession #
P37058
GenBank Nucleotide #
NM_000197.1
NCBI Official Full Name
testosterone 17-beta-dehydrogenase 3
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 3
NCBI Official Symbol
HSD17B3
NCBI Official Synonym Symbols
EDH17B3; SDR12C2
UniProt Protein Name
Testosterone 17-beta-dehydrogenase 3
UniProt Synonym Protein Names
17-beta-hydroxysteroid dehydrogenase type 3; 17-beta-HSD 3; Testicular 17-beta-hydroxysteroid dehydrogenase
Protein Family
Testosterone 17-beta-dehydrogenase
UniProt Gene Name
HSD17B3
UniProt Synonym Gene Names
EDH17B3; 17-beta-HSD 3
UniProt Entry Name
DHB3_HUMAN
NCBI Protein Information
testosterone 17-beta-dehydrogenase 3; 17-beta-HSD3; 17-beta-HSD 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 12C, member 2

UniProt Comments for HSD17B3

HSD17B3: Favors the reduction of androstenedione to testosterone. Uses NADPH while the two other EDH17B enzymes use NADH. Defects in HSD17B3 are the cause of male pseudohermaphrodism with gynecomastia (MPH). These individuals have unambiguous female external genitalia at birth, but fail to menstruate at the time of expected puberty and instead virilize as evidenced by growth of the phallus. Breast development may or may not take place. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.

Protein type: EC 1.1.1.64; Oxidoreductase; Lipid Metabolism - androgen and estrogen

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle

Molecular Function: testosterone 17-beta-dehydrogenase (NADP+) activity

Biological Process: steroid metabolic process; male genitalia development; androgen biosynthetic process

Disease: 17-beta Hydroxysteroid Dehydrogenase Iii Deficiency
Show more

Research Articles on HSD17B3

1. These results suggest that the HSD17B3 G289S polymorphism may be a potential risk modifier for hypospadias.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HSD17B3 antibody

 Reference Product  PubMed Publications
 CYP17A1 antibody  >24 publications with HSD17B3 and CYP17A1
 SRD5A2 antibody  >15 publications with HSD17B3 and SRD5A2
 CYP19A1 antibody  >13 publications with HSD17B3 and CYP19A1
 HSD3B1 antibody  >12 publications with HSD17B3 and HSD3B1
 SRD5A1 antibody  >8 publications with HSD17B3 and SRD5A1
 HSD3B2 antibody  >5 publications with HSD17B3 and HSD3B2
 UGT2B17 antibody  >3 publications with HSD17B3 and UGT2B17
 UGT2B15 antibody  >3 publications with HSD17B3 and UGT2B15

Pathways associated with anti-HSD17B3 antibody

 Products by Pathway  Pathway Diagram
 Androgen Biosynthesis Pathway antibodies  Androgen Biosynthesis Pathway Diagram
 Fatty Acyl-CoA Biosynthesis Pathway antibodies  Fatty Acyl-CoA Biosynthesis Pathway Diagram
 Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway antibodies  Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Lipids And Lipoproteins Pathway antibodies  Metabolism Of Lipids And Lipoproteins Pathway Diagram
 Metabolism Of Steroid Hormones And Vitamin D Pathway antibodies  Metabolism Of Steroid Hormones And Vitamin D Pathway Diagram
 Prostate Cancer Pathway antibodies  Prostate Cancer Pathway Diagram
 Steroid Biosynthesis Pathway antibodies  Steroid Biosynthesis Pathway Diagram
 Steroid Hormone Biosynthesis Pathway antibodies  Steroid Hormone Biosynthesis Pathway Diagram
 Steroid Hormone Biosynthesis Pathway antibodies  Steroid Hormone Biosynthesis Pathway Diagram

Diseases associated with anti-HSD17B3 antibody

 Disease Name  Pubmed Publications
 Urogenital Abnormalities Antibodies  >19 publications with HSD17B3 and Urogenital Abnormalities
 Disorders of Sex Development Antibodies  >18 publications with HSD17B3 and Disorders of Sex Development
 Mental Disorders Antibodies  >15 publications with HSD17B3 and Mental Disorders
 Genital Diseases, Male Antibodies  >14 publications with HSD17B3 and Genital Diseases, Male
 Prostatic Diseases Antibodies  >10 publications with HSD17B3 and Prostatic Diseases
 Prostatic Neoplasms Antibodies  >9 publications with HSD17B3 and Prostatic Neoplasms
 Hyperplasia Antibodies  >4 publications with HSD17B3 and Hyperplasia
 Ovarian Diseases Antibodies  >3 publications with HSD17B3 and Ovarian Diseases
 Infertility, Male Antibodies  >3 publications with HSD17B3 and Infertility, Male
 Prenatal Exposure Delayed Effects Antibodies  >2 publications with HSD17B3 and Prenatal Exposure Delayed Effects

Organs/Tissues associated with anti-HSD17B3 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >28 publications with HSD17B3 and Testis
 Brain Antibodies  >6 publications with HSD17B3 and Brain
 Placenta Antibodies  >1 publications with HSD17B3 and Placenta
 Uncharacterized Tissue Antibodies  >1 publications with HSD17B3 and Uncharacterized Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000