Rabbit Anti-MAD2L2 Polyclonal Antibody – Cat# MBS6384571

MAD2L2 Antibody – Rabbit Polyclonal

Name: MAD2L2 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6384571
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6384571

Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1, thereby mediating the… More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MAD2L2, Polyclonal Antibody

Full Product Name

MAD2L2 (Mitotic Spindle Assembly Checkpoint Protein MAD2B, MAD2-like 2, Mitotic Arrest Deficient 2-like Protein 2, MAD2-like Protein 2, REV7 Homolog, hREV7, REV7) (MaxLight 490)

Product Gene Name

anti-MAD2L2 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human MAD2L2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

24,334 Da

Immunogen

Full-length human MAD2L2, aa1-211 (AAH15244.1).

Immunogen Sequence

MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Conjugate

MaxLight490

Note

Preservative Free

Product Categories/Family for anti-MAD2L2 antibody

Antibodies; Cell Division Cycle (CDC)

Applications Tested/Suitable for anti-MAD2L2 antibody

Western Blot (WB)

Application Notes for anti-MAD2L2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-MAD2L2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MAD2L2 purchase

MBS6384571 is an antibody targeting MAD2L2. Also known as MAD2L2 (Mitotic Spindle Assembly Checkpoint Protein MAD2B, MAD2-like 2, Mitotic Arrest Deficient 2-like Protein 2, MAD2-like Protein 2, REV7 Homolog, hREV7, REV7) (MaxLight 490). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for MAD2L2. It may not necessarily be applicable to this product.

NCBI GI #

15929611

NCBI GeneID

10459

NCBI Accession #

BC015244

UniProt Secondary Accession #

Q5TGW7; Q9UNA7; Q9Y6I6; B3KNE3

UniProt Related Accession #

Q9UI95

NCBI Official Full Name

Homo sapiens MAD2 mitotic arrest deficient-like 2 (yeast), mRNA

NCBI Official Synonym Full Names

MAD2 mitotic arrest deficient-like 2 (yeast)

NCBI Official Symbol

MAD2L2

NCBI Official Synonym Symbols

REV7; MAD2B; POLZ2

Protein Family

Mitotic spindle assembly checkpoint protein

NCBI Protein Information

mitotic spindle assembly checkpoint protein MAD2B

NCBI Summary for MAD2L2

The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. [provided by RefSeq, Jul 2008]

Research Articles on MAD2L2

1. hMAD2 also binds to the hREV7-binding sequence in hREV3, whereas hMAD2 does not bind to a similar sequence in ADAM9 or ELK-1 and hREV7 does not bind to the hMAD2-binding sequence in hMAD1 or hCDC20.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-MAD2L2 antibody

Products by Pathway	Pathway Diagram
Bacterial Invasion Of Epithelial Cells Pathway antibodies	Bacterial Invasion Of Epithelial Cells Pathway Diagram
Bacterial Invasion Of Epithelial Cells Pathway antibodies	Bacterial Invasion Of Epithelial Cells Pathway Diagram
Cell Cycle Pathway antibodies	Cell Cycle Pathway Diagram
Cell Cycle Pathway antibodies	Cell Cycle Pathway Diagram
Cell Cycle Pathway antibodies	Cell Cycle Pathway Diagram
DNA Damage Bypass Pathway antibodies	DNA Damage Bypass Pathway Diagram
DNA Repair Pathway antibodies	DNA Repair Pathway Diagram
DNA Polymerase Zeta Complex Pathway antibodies	DNA Polymerase Zeta Complex Pathway Diagram
DNA Polymerase Zeta Complex Pathway antibodies	DNA Polymerase Zeta Complex Pathway Diagram
Oocyte Meiosis Pathway antibodies	Oocyte Meiosis Pathway Diagram

Diseases associated with anti-MAD2L2 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>20 publications with MAD2L2 and Neoplasms
Adenocarcinoma Antibodies	>6 publications with MAD2L2 and Adenocarcinoma
Nervous System Diseases Antibodies	>4 publications with MAD2L2 and Nervous System Diseases
Death Antibodies	>4 publications with MAD2L2 and Death
Kidney Diseases Antibodies	>3 publications with MAD2L2 and Kidney Diseases
Brain Diseases Antibodies	>2 publications with MAD2L2 and Brain Diseases
Drug Toxicity Antibodies	>2 publications with MAD2L2 and Drug Toxicity
Carcinoma, Hepatocellular Antibodies	>2 publications with MAD2L2 and Carcinoma, Hepatocellular
Anemia Antibodies	>2 publications with MAD2L2 and Anemia
Liver Diseases Antibodies	>2 publications with MAD2L2 and Liver Diseases

Organs/Tissues associated with anti-MAD2L2 antibody

Organ/Tissue Name	Pubmed Publications
Kidney Antibodies	>3 publications with MAD2L2 and Kidney
Liver Antibodies	>3 publications with MAD2L2 and Liver
Brain Antibodies	>3 publications with MAD2L2 and Brain
Testis Antibodies	>2 publications with MAD2L2 and Testis
Intestine Antibodies	>2 publications with MAD2L2 and Intestine
Embryonic Tissue Antibodies	>2 publications with MAD2L2 and Embryonic Tissue
Prostate Antibodies	>1 publications with MAD2L2 and Prostate
Lung Antibodies	>1 publications with MAD2L2 and Lung
Muscle Antibodies	>1 publications with MAD2L2 and Muscle
Skin Antibodies	>1 publications with MAD2L2 and Skin