• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MDH1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6385138

MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. More details

$1165 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MDH1, Polyclonal Antibody
Full Product Name
MDH1 (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDHA) APC
Product Gene Name
anti-MDH1 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human MDH1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
38,628 Da
OMIM
154200
3D Structure
ModBase 3D Structure for P40925
Immunogen
Full length human MDH1, aa1-334 (NP_005908.1).
Immunogen Sequence
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Conjugate
APC
Note
Preservative Free

Product Categories/Family for anti-MDH1 antibody

Antibodies; Enzymes; Dehydrogenase
Applications Tested/Suitable for anti-MDH1 antibody
Western Blot (WB)
Application Notes for anti-MDH1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-MDH1 antibody

MDH1 rabbit polyclonal antibody. Western Blot analysis of MDH1 expression in human spleen.
Rabbit Anti-MDH1 Polyclonal Antibody – Cat# MBS6385138

Western Blot (WB) of anti-MDH1 antibody

Western Blot analysis of MDH1 expression in transfected 293T cell line by MDH1 polyclonal antibody. Lane 1: MDH1 transfected lysate (36.4kD). Lane 2: Non-transfected lysate.
Rabbit Anti-MDH1 Polyclonal Antibody, Western Blot (WB) – Cat# MBS6385138

Other Notes

Small volumes of anti-MDH1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MDH1 purchase

MBS6385138 is an antibody targeting MDH1. Also known as MDH1 (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDHA) APC. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for MDH1. It may not necessarily be applicable to this product.

NCBI GI #
5174539
NCBI GeneID
4190
NCBI Accession #
NP_005908.1
UniProt Primary Accession #
P40925
UniProt Secondary Accession #
Q6I9V0; B2R5V5; B4DUN2; B7Z3I7; F5H098
UniProt Related Accession #
P40925
GenBank Nucleotide #
NM_005917.2
NCBI Official Full Name
malate dehydrogenase, cytoplasmic isoform 2
NCBI Official Synonym Full Names
malate dehydrogenase 1, NAD (soluble)
NCBI Official Symbol
MDH1
NCBI Official Synonym Symbols
MDHA; MOR2; MDH-s; HEL-S-32; MGC:1375
UniProt Protein Name
Malate dehydrogenase, cytoplasmic
UniProt Synonym Protein Names
Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase (EC:1.1.1.96)
Protein Family
Malate dehydrogenase
UniProt Gene Name
MDH1
UniProt Synonym Gene Names
MDHA
UniProt Entry Name
MDHC_HUMAN
NCBI Protein Information
malate dehydrogenase, cytoplasmic; soluble malate dehydrogenase; cytosolic malate dehydrogenase; diiodophenylpyruvate reductase; epididymis secretory protein Li 32

NCBI Summary for MDH1

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Nov 2010]
Show more

UniProt Comments for MDH1

MDH1: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Nov 2010]

Protein type: EC 1.1.1.96; Carbohydrate Metabolism - pyruvate; Oxidoreductase; Carbohydrate Metabolism - citrate (TCA) cycle; EC 1.1.1.37; Carbohydrate Metabolism - glyoxylate and dicarboxylate

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: centrosome; extracellular space; mitochondrion; cytoplasm; cytosol

Molecular Function: malic enzyme activity; L-malate dehydrogenase activity; diiodophenylpyruvate reductase activity; NAD binding

Biological Process: malate metabolic process; oxaloacetate metabolic process; NADH metabolic process; tricarboxylic acid cycle; carbohydrate metabolic process; glucose metabolic process; cellular carbohydrate metabolic process; pathogenesis; gluconeogenesis
Show more

Research Articles on MDH1

1. adipogenic differentiation may be regulated by the acetylation of MDH1

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MDH1 antibody

 Reference Product  PubMed Publications
 ME1 antibody  >5 publications with MDH1 and ME1
 GOT1 antibody  >5 publications with MDH1 and GOT1
 GOT2 antibody  >3 publications with MDH1 and GOT2
 PCK1 antibody  >1 publications with MDH1 and PCK1

Pathways associated with anti-MDH1 antibody

 Products by Pathway  Pathway Diagram
 Carbon Metabolism Pathway antibodies  Carbon Metabolism Pathway Diagram
 Carbon Metabolism Pathway antibodies  Carbon Metabolism Pathway Diagram
 Citrate Cycle (TCA Cycle) Pathway antibodies  Citrate Cycle (TCA Cycle) Pathway Diagram
 Citrate Cycle (TCA Cycle) Pathway antibodies  Citrate Cycle (TCA Cycle) Pathway Diagram
 Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway antibodies  Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway Diagram
 Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway antibodies  Citrate Cycle (TCA Cycle, Krebs Cycle) Pathway Diagram
 Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate => Oxaloacetate Pathway antibodies  Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate => Oxaloacetate Pathway Diagram
 Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate => Oxaloacetate Pathway antibodies  Citrate Cycle, Second Carbon Oxidation, 2-oxoglutarate => Oxaloacetate Pathway Diagram
 Cysteine And Methionine Metabolism Pathway antibodies  Cysteine And Methionine Metabolism Pathway Diagram
 Cysteine And Methionine Metabolism Pathway antibodies  Cysteine And Methionine Metabolism Pathway Diagram

Diseases associated with anti-MDH1 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >5 publications with MDH1 and Nervous System Diseases
 Brain Diseases Antibodies  >3 publications with MDH1 and Brain Diseases
 Disease Models, Animal Antibodies  >2 publications with MDH1 and Disease Models, Animal
 Heart Diseases Antibodies  >2 publications with MDH1 and Heart Diseases
 Vascular Diseases Antibodies  >2 publications with MDH1 and Vascular Diseases
 Neurobehavioral Manifestations Antibodies  >1 publications with MDH1 and Neurobehavioral Manifestations
 Dyslipidemias Antibodies  >1 publications with MDH1 and Dyslipidemias
 Seizures Antibodies  >1 publications with MDH1 and Seizures
 Kidney Diseases Antibodies  >1 publications with MDH1 and Kidney Diseases
 Fibrosis Antibodies  >1 publications with MDH1 and Fibrosis

Organs/Tissues associated with anti-MDH1 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >15 publications with MDH1 and Blood
 Brain Antibodies  >10 publications with MDH1 and Brain
 Muscle Antibodies  >6 publications with MDH1 and Muscle
 Liver Antibodies  >5 publications with MDH1 and Liver
 Heart Antibodies  >4 publications with MDH1 and Heart
 Intestine Antibodies  >3 publications with MDH1 and Intestine
 Nerve Antibodies  >3 publications with MDH1 and Nerve
 Kidney Antibodies  >2 publications with MDH1 and Kidney
 Lung Antibodies  >2 publications with MDH1 and Lung
 Eye Antibodies  >1 publications with MDH1 and Eye
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000