Rabbit Anti-NDUFA5 Polyclonal Antibody – Cat# MBS6386638

NDUFA5 Antibody – Rabbit Polyclonal

Name: NDUFA5 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6386638
Price: 965 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6386638

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron… More details

$965 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

NDUFA5, Polyclonal Antibody

Full Product Name

NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5, Complex I Subunit B13, Complex I-13kD-B, CI-13kD-B, NADH-ubiquinone Oxidoreductase 13kD-B Subunit, DKFZp781K1356, FLJ12147) (MaxLight 405)

Product Gene Name

anti-NDUFA5 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human NDUFA5.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

601677

3D Structure

ModBase 3D Structure for Q16718

Immunogen

Full length human NDUFA5, aa1-116 (NP_004991.1).

Immunogen Sequence

MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Conjugate

MaxLight405

Note

Preservative Free

Product Categories/Family for anti-NDUFA5 antibody

Antibodies; Enzymes; Dehydrogenase

Applications Tested/Suitable for anti-NDUFA5 antibody

Western Blot (WB)

Application Notes for anti-NDUFA5 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-NDUFA5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NDUFA5 purchase

MBS6386638 is an antibody targeting NDUFA5. Also known as NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5, Complex I Subunit B13, Complex I-13kD-B, CI-13kD-B, NADH-ubiquinone Oxidoreductase 13kD-B Subunit, DKFZp781K1356, FLJ12147) (MaxLight 405). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for NDUFA5. It may not necessarily be applicable to this product.

NCBI GI #

4826848

NCBI GeneID

4698

NCBI Accession #

NP_004991.1

UniProt Primary Accession #

Q16718

UniProt Related Accession #

Q16718

GenBank Nucleotide #

NM_005000.2

NCBI Official Full Name

NADH dehydrogenase

NCBI Official Synonym Full Names

NADH:ubiquinone oxidoreductase subunit A5

NCBI Official Symbol

NDUFA5

NCBI Official Synonym Symbols

B13; NUFM; UQOR13; CI-13kB; CI-13KD-B

UniProt Protein Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

UniProt Synonym Protein Names

Complex I subunit B13; Complex I-13kD-B; CI-13kD-B; NADH-ubiquinone oxidoreductase 13 kDa-B subunit

Protein Family

NADH dehydrogenase

UniProt Gene Name

NDUFA5

UniProt Synonym Gene Names

CI-13kD-B

UniProt Entry Name

NDUA5_HUMAN

NCBI Protein Information

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

NCBI Summary for NDUFA5

This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16. [provided by RefSeq, Apr 2014]

UniProt Comments for NDUFA5

NDUFA5: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFA5 subunit family.

Protein type: EC 1.6.5.3; Mitochondrial; Energy Metabolism - oxidative phosphorylation; Oxidoreductase; EC 1.6.99.3

Chromosomal Location of Human Ortholog: 7q31.33

Cellular Component: mitochondrial inner membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Research Articles on NDUFA5

1. NDUFA3, NDUFA5 and NDUFA12 supernumerary subunits are necessary for complex I activity and biogenesis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-NDUFA5 antibody

Products by Pathway	Pathway Diagram
Alzheimer's Disease Pathway antibodies	Alzheimer's Disease Pathway Diagram
Alzheimer's Disease Pathway antibodies	Alzheimer's Disease Pathway Diagram
Electron Transport Chain Pathway antibodies	Electron Transport Chain Pathway Diagram
Huntington's Disease Pathway antibodies	Huntington's Disease Pathway Diagram
Huntington's Disease Pathway antibodies	Huntington's Disease Pathway Diagram
Metabolic Pathways antibodies	Metabolic Pathways Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram
NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway antibodies	NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway Diagram
NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway antibodies	NADH Dehydrogenase (ubiquinone) 1 Alpha Subcomplex Pathway Diagram
Non-alcoholic Fatty Liver Disease (NAFLD) Pathway antibodies	Non-alcoholic Fatty Liver Disease (NAFLD) Pathway Diagram

Diseases associated with anti-NDUFA5 antibody

Disease Name	Pubmed Publications
Nervous System Diseases Antibodies	>3 publications with NDUFA5 and Nervous System Diseases
Brain Diseases Antibodies	>3 publications with NDUFA5 and Brain Diseases
Breast Neoplasms Antibodies	>2 publications with NDUFA5 and Breast Neoplasms
Death Antibodies	>1 publications with NDUFA5 and Death
Heart Diseases Antibodies	>1 publications with NDUFA5 and Heart Diseases

Organs/Tissues associated with anti-NDUFA5 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>4 publications with NDUFA5 and Brain
Nerve Antibodies	>1 publications with NDUFA5 and Nerve
Skin Antibodies	>1 publications with NDUFA5 and Skin
Heart Antibodies	>1 publications with NDUFA5 and Heart
Pancreas Antibodies	>1 publications with NDUFA5 and Pancreas