• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PCGF1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6388614

Component of the Polycomb group (PcG) multiprotein BCOR complex, a complex required to maintain the transcriptionally repressive state of some genes, such as BCL6 and the cyclin-dependent kinase inhibitor, CDKN1A. Transcriptional repressor that may be… More details

$1165 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PCGF1, Polyclonal Antibody
Full Product Name
PCGF1 (Polycomb Group RING Finger Protein 1, Nervous System Polycomb-1, NSPc1, RING Finger Protein 68, NSPC1, RNF68, FLJ43754, MGC10882) APC
Product Gene Name
anti-PCGF1 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PCGF1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunogen
Full length human PCGF1, aa1-247 (AAH04952.1).
Immunogen Sequence
MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
Conjugate
APC
Note
Preservative Free

Product Categories/Family for anti-PCGF1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger
Applications Tested/Suitable for anti-PCGF1 antibody
Western Blot (WB)
Application Notes for anti-PCGF1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PCGF1 antibody

PCGF1 rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat.
Rabbit Anti-PCGF1 Polyclonal Antibody – Cat# MBS6388614

Western Blot (WB) of anti-PCGF1 antibody

Western Blot analysis of PCGF1 expression in transfected 293T cell line by PCGF1 polyclonal antibody. Lane 1: PCGF1 transfected lysate (29.2kD). Lane 2: Non-transfected lysate.
Rabbit Anti-PCGF1 Polyclonal Antibody, Western Blot (WB) – Cat# MBS6388614

Other Notes

Small volumes of anti-PCGF1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PCGF1 purchase

MBS6388614 is an antibody targeting PCGF1. Also known as PCGF1 (Polycomb Group RING Finger Protein 1, Nervous System Polycomb-1, NSPc1, RING Finger Protein 68, NSPC1, RNF68, FLJ43754, MGC10882) APC. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PCGF1. It may not necessarily be applicable to this product.

NCBI GI #
13436325
NCBI GeneID
84759
NCBI Accession #
BC004952.1
NCBI Related Accession #
AAH04952.1
UniProt Related Accession #
Q9BSM1
NCBI Official Full Name
Homo sapiens polycomb group ring finger 1, mRNA
NCBI Official Synonym Full Names
polycomb group ring finger 1
NCBI Official Symbol
PCGF1
NCBI Official Synonym Symbols
NSPC1; RNF68; RNF3A-2; 2010002K04Rik
Protein Family
Polycomb group RING finger protein
NCBI Protein Information
polycomb group RING finger protein 1

NCBI Summary for PCGF1

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM, Aug 2008]

Research Articles on PCGF1

1. The results of the present study demonstrated that miR320a inhibition decreased insulininduced KGN cell proliferation and apoptosis by targeting PCGF1.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-PCGF1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >1 publications with PCGF1 and Neoplasms
 Necrosis Antibodies  >1 publications with PCGF1 and Necrosis
 Inflammation Antibodies  >1 publications with PCGF1 and Inflammation

Organs/Tissues associated with anti-PCGF1 antibody

 Organ/Tissue Name  Pubmed Publications
 Ascites Antibodies  >1 publications with PCGF1 and Ascites
 Placenta Antibodies  >1 publications with PCGF1 and Placenta
 Eye Antibodies  >1 publications with PCGF1 and Eye
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000