Rabbit Anti-PGDS Polyclonal Antibody – Cat# MBS6389186

Western Blot analysis of PGDS expression in transfected 293T cell line by PGDS polyclonal antibody. Lane 1: PGDS transfected lysate (23.3kD). Lane 2: Non-transfected lysate.

PGDS Antibody – Rabbit Polyclonal

Name: PGDS Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6389186
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6389186

HPGDS, also known as GSTS, is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be… More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PGDS, Polyclonal Antibody

Full Product Name

PGDS (HPGDS, Hematopoietic Prostaglandin D Synthase, H-PGDS, GST Class-sigma, Glutathione S-transferase, Glutathione-dependent PGD Synthase, Glutathione-requiring Prostaglandin D Synthase, Prostaglandin-H2 D-isomerase, GSTS, PTGDS2) APC

Product Gene Name

anti-PGDS antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human PGDS.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

602598

3D Structure

ModBase 3D Structure for O60760

Immunogen

Full length human PGDS, aa1-199 (NP_055300.1).

Immunogen Sequence

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

Conjugate

APC

Note

Preservative Free

Product Categories/Family for anti-PGDS antibody

Antibodies; Prostaglandins

Applications Tested/Suitable for anti-PGDS antibody

Western Blot (WB)

Application Notes for anti-PGDS antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PGDS antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PGDS purchase

MBS6389186 is an antibody targeting PGDS. Also known as PGDS (HPGDS, Hematopoietic Prostaglandin D Synthase, H-PGDS, GST Class-sigma, Glutathione S-transferase, Glutathione-dependent PGD Synthase, Glutathione-requiring Prostaglandin D Synthase, Prostaglandin-H2 D-isomerase, GSTS, PTGDS2) APC. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PGDS. It may not necessarily be applicable to this product.

NCBI GI #

62422566

NCBI GeneID

27306

NCBI Accession #

NM_014485.2

UniProt Primary Accession #

O60760

UniProt Related Accession #

O60760

GenBank Nucleotide #

NM_014485.2

NCBI Official Full Name

Homo sapiens hematopoietic prostaglandin D synthase (HPGDS), mRNA

NCBI Official Synonym Full Names

hematopoietic prostaglandin D synthase

NCBI Official Symbol

HPGDS

NCBI Official Synonym Symbols

GSTS; PGD2; PGDS; GSTS1; GSTS1-1

UniProt Protein Name

Hematopoietic prostaglandin D synthase

UniProt Synonym Protein Names

GST class-sigma; Glutathione S-transferase (EC:2.5.1.18); Glutathione-dependent PGD synthase; Glutathione-requiring prostaglandin D synthase; Prostaglandin-H2 D-isomerase

Protein Family

Gamma-DL-glutamyl hydrolase

UniProt Gene Name

HPGDS

UniProt Synonym Gene Names

GSTS; PGDS; PTGDS2; H-PGDS

UniProt Entry Name

HPGDS_HUMAN

NCBI Protein Information

hematopoietic prostaglandin D synthase

NCBI Summary for PGDS

Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. [provided by RefSeq, Jul 2008]

UniProt Comments for PGDS

Ptgds2: Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide. Belongs to the GST superfamily. Sigma family.

Protein type: EC 2.5.1.18; Lipid Metabolism - arachidonic acid; EC 5.3.99.2; Isomerase

Chromosomal Location of Human Ortholog: 4q22.3

Cellular Component: cytoplasm; cytosol

Molecular Function: prostaglandin-D synthase activity; protein homodimerization activity; glutathione transferase activity; magnesium ion binding; calcium ion binding

Biological Process: xenobiotic metabolic process; cyclooxygenase pathway; arachidonic acid metabolic process; locomotory behavior; signal transduction; prostaglandin metabolic process

Research Articles on PGDS

1. we have utilized a broad-scaled affinity proteomics approach to identify three proteins (CCL5, HPGDS, and NPSR1) with altered plasma levels in asthmatic children compared to healthy controls, representing the first evaluation of HPGDS and NPSR1 in plasma.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.