• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PLA2G10 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6389644

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those… More details

$1165 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PLA2G10, Polyclonal Antibody
Full Product Name
PLA2G10 (Group 10 Secretory Phospholipase A2, Group X Secretory Phospholipase A2, GX sPLA2, sPLA2-X, Phosphatidylcholine 2-acylhydrolase 10, MGC119918, MGC119919, MGC133367) (MaxLight 650)
Product Gene Name
anti-PLA2G10 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PLA2G10.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
18,153 Da
OMIM
603603
3D Structure
ModBase 3D Structure for O15496
Immunogen
Full length human PLA2G10, aa1-165 (NP_003552.1).
Immunogen Sequence
MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Conjugate
MaxLight650
Note
Preservative Free

Product Categories/Family for anti-PLA2G10 antibody

Antibodies; Enzymes; Phospholipase
Applications Tested/Suitable for anti-PLA2G10 antibody
Western Blot (WB)
Application Notes for anti-PLA2G10 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PLA2G10 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PLA2G10 purchase

MBS6389644 is an antibody targeting PLA2G10. Also known as PLA2G10 (Group 10 Secretory Phospholipase A2, Group X Secretory Phospholipase A2, GX sPLA2, sPLA2-X, Phosphatidylcholine 2-acylhydrolase 10, MGC119918, MGC119919, MGC133367) (MaxLight 650). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PLA2G10. It may not necessarily be applicable to this product.

NCBI GI #
4505845
NCBI GeneID
8399
NCBI Accession #
NP_003552.1
UniProt Primary Accession #
O15496
UniProt Secondary Accession #
Q14DU3; Q6NT23
UniProt Related Accession #
O15496
GenBank Nucleotide #
NM_003561.1
NCBI Official Full Name
group 10 secretory phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2, group X
NCBI Official Symbol
PLA2G10
NCBI Official Synonym Symbols
SPLA2; GXPLA2; GXSPLA2
UniProt Protein Name
Group 10 secretory phospholipase A2
UniProt Synonym Protein Names
Group X secretory phospholipase A2; GX sPLA2; sPLA2-X; Phosphatidylcholine 2-acylhydrolase 10
Protein Family
Group 10 secretory phospholipase
UniProt Gene Name
PLA2G10
UniProt Synonym Gene Names
GX sPLA2; sPLA2-X
UniProt Entry Name
PA2GX_HUMAN
NCBI Protein Information
group 10 secretory phospholipase A2; GX sPLA2; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; sPLA2-X

UniProt Comments for PLA2G10

PLA2G10: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine. Belongs to the phospholipase A2 family.

Protein type: Secreted; Lipid Metabolism - arachidonic acid; Secreted, signal peptide; Cell development/differentiation; Lipid Metabolism - ether lipid; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - linoleic acid; Phospholipase; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 16p13.1-p12

Cellular Component: extracellular region

Molecular Function: phospholipase A2 activity; calcium ion binding; phospholipase activity

Biological Process: axon guidance; cholesterol homeostasis; phospholipid metabolic process; negative regulation of transcription factor activity; regulation of macrophage activation; lysophospholipid transport; positive regulation of cellular protein metabolic process; glycerophospholipid biosynthetic process; positive regulation of prostaglandin secretion; phosphatidic acid biosynthetic process; arachidonic acid metabolic process; lipid catabolic process
Show more

Research Articles on PLA2G10

1. hGX sPLA2 is a novel modulator of lipid metabolism that promotes breast cancer cell growth and survival by stimulating lipid droplet formation and fatty acid oxidation.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PLA2G10 antibody

 Reference Product  PubMed Publications
 PTGS2 antibody  >4 publications with PLA2G10 and PTGS2
 PLA2G15 antibody  >1 publications with PLA2G10 and PLA2G15
 PLA2G7 antibody  >1 publications with PLA2G10 and PLA2G7

Pathways associated with anti-PLA2G10 antibody

 Products by Pathway  Pathway Diagram
 Acyl Chain Remodelling Of PC Pathway antibodies  Acyl Chain Remodelling Of PC Pathway Diagram
 Acyl Chain Remodelling Of PE Pathway antibodies  Acyl Chain Remodelling Of PE Pathway Diagram
 Acyl Chain Remodelling Of PG Pathway antibodies  Acyl Chain Remodelling Of PG Pathway Diagram
 Acyl Chain Remodelling Of PI Pathway antibodies  Acyl Chain Remodelling Of PI Pathway Diagram
 Acyl Chain Remodelling Of PS Pathway antibodies  Acyl Chain Remodelling Of PS Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Ether Lipid Metabolism Pathway antibodies  Ether Lipid Metabolism Pathway Diagram
 Ether Lipid Metabolism Pathway antibodies  Ether Lipid Metabolism Pathway Diagram
 Fat Digestion And Absorption Pathway antibodies  Fat Digestion And Absorption Pathway Diagram

Diseases associated with anti-PLA2G10 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >15 publications with PLA2G10 and Inflammation
 Cardiovascular Diseases Antibodies  >13 publications with PLA2G10 and Cardiovascular Diseases
 Atherosclerosis Antibodies  >10 publications with PLA2G10 and Atherosclerosis
 Lung Diseases Antibodies  >6 publications with PLA2G10 and Lung Diseases
 Heart Diseases Antibodies  >5 publications with PLA2G10 and Heart Diseases
 Necrosis Antibodies  >4 publications with PLA2G10 and Necrosis
 Fatty Liver Antibodies  >2 publications with PLA2G10 and Fatty Liver
 Liver Diseases Antibodies  >2 publications with PLA2G10 and Liver Diseases
 Carcinoma, Hepatocellular Antibodies  >1 publications with PLA2G10 and Carcinoma, Hepatocellular
 Eye Diseases Antibodies  >1 publications with PLA2G10 and Eye Diseases

Organs/Tissues associated with anti-PLA2G10 antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >6 publications with PLA2G10 and Lung
 Intestine Antibodies  >1 publications with PLA2G10 and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000