• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PTPN7 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6391431

PTPN7 is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN7 is… More details

$1165 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PTPN7, Polyclonal Antibody
Full Product Name
PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (Biotin)
Product Gene Name
anti-PTPN7 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PTPN7.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
43.1 kDa (384aa), confirmed by MALDI-TOF
Immunogen
Full length human PTPN7, aa1-360 (NP_002823.2).
Immunogen Sequence
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Conjugate
Biotin
Note
Preservative Free

Product Categories/Family for anti-PTPN7 antibody

Antibodies; Enzymes; Phosphatase
Applications Tested/Suitable for anti-PTPN7 antibody
Western Blot (WB)
Application Notes for anti-PTPN7 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PTPN7 antibody

Western Blot analysis of PTPN7 expression in transfected 293T cell line by PTPN7 polyclonal antibody. Lane 1: PTPN7 transfected lysate (40.5kD). Lane 2: Non-transfected lysate.
Rabbit Anti-PTPN7 Polyclonal Antibody – Cat# MBS6391431

Testing Data of anti-PTPN7 antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between PTPN7 and MAPK1 HeLa cells were stained with PTPN7 rabbit purified polyclonal 1:1200 and MAPK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Rabbit Anti-PTPN7 Polyclonal Antibody, Testing Data – Cat# MBS6391431

Other Notes

Small volumes of anti-PTPN7 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PTPN7 purchase

MBS6391431 is an antibody targeting PTPN7. Also known as PTPN7 (Tyrosine-protein Phosphatase Non-receptor Type 7, Protein-tyrosine Phosphatase LC-PTP, Hematopoietic Protein-tyrosine Phosphatase, HEPTP) (Biotin). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PTPN7. It may not necessarily be applicable to this product.

NCBI GI #
18375658
NCBI GeneID
5778
NCBI Accession #
NP_002823.2
UniProt Secondary Accession #
Q53XK4; Q5SXQ0; Q5SXQ1; Q9BV05; B3KXE1
UniProt Related Accession #
P35236
GenBank Nucleotide #
NM_002832.2
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 7 isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 7
NCBI Official Symbol
PTPN7
NCBI Official Synonym Symbols
LPTP; HEPTP; PTPNI; BPTP-4; LC-PTP
Protein Family
Tyrosine-protein phosphatase non-receptor
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 7

NCBI Summary for PTPN7

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This gene is preferentially expressed in a variety of hematopoietic cells, and is an early response gene in lymphokine stimulated cells. The non-catalytic N-terminus of this PTP can interact with MAP kinases and suppress the MAP kinase activities. This PTP was shown to be involved in the regulation of T cell antigen receptor (TCR) signaling, which was thought to function through dephosphorylating the molecules related to MAP kinase pathway. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2010]
Show more

Research Articles on PTPN7

1. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PTPN7 antibody

 Reference Product  PubMed Publications
 MAPK1 antibody  >10 publications with PTPN7 and MAPK1
 MAPK3 antibody  >5 publications with PTPN7 and MAPK3
 MAPK14 antibody  >3 publications with PTPN7 and MAPK14

Pathways associated with anti-PTPN7 antibody

 Products by Pathway  Pathway Diagram
 Downstream Signaling In Naive CD8+ T Cells Pathway antibodies  Downstream Signaling In Naive CD8+ T Cells Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 MAPK Signaling Pathway antibodies  MAPK Signaling Pathway Diagram
 Ras Signaling In The CD4+ TCR Pathway antibodies  Ras Signaling In The CD4+ TCR Pathway Diagram

Diseases associated with anti-PTPN7 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >3 publications with PTPN7 and Inflammation
 Necrosis Antibodies  >2 publications with PTPN7 and Necrosis
 Hematologic Diseases Antibodies  >1 publications with PTPN7 and Hematologic Diseases

Organs/Tissues associated with anti-PTPN7 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >9 publications with PTPN7 and Blood
 Lung Antibodies  >1 publications with PTPN7 and Lung
 Kidney Antibodies  >1 publications with PTPN7 and Kidney
 Brain Antibodies  >1 publications with PTPN7 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000