Rabbit Anti-RTN3 Polyclonal Antibody – Cat# MBS6393076

Western Blot analysis of RTN3 expression in transfected 293T cell line by 132880. Lane 1: RTN3 transfected lysate (25.6kD). Lane 2: Non-transfected lysate.

RTN3 Antibody – Rabbit Polyclonal

Name: RTN3 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6393076
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6393076

May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum… More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

RTN3, Polyclonal Antibody

Full Product Name

RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) (MaxLight 650)

Product Gene Name

anti-RTN3 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human RTN3.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

100,824 Da

OMIM

604249

3D Structure

ModBase 3D Structure for O95197

Immunogen

Full-length recombinant protein corresponding to aa1-236 from human RTN3.

Immunogen Sequence

MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE

Conjugate

MaxLight650

Note

Preservative Free

Product Categories/Family for anti-RTN3 antibody

Antibodies; Proteins

Applications Tested/Suitable for anti-RTN3 antibody

Western Blot (WB)

Application Notes for anti-RTN3 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-RTN3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RTN3 purchase

MBS6393076 is an antibody targeting RTN3. Also known as RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) (MaxLight 650). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for RTN3. It may not necessarily be applicable to this product.

NCBI GI #

5174655

NCBI GeneID

10313

NCBI Accession #

NP_006045.1

UniProt Primary Accession #

O95197

UniProt Secondary Accession #

Q147U9; Q496K2; Q53GN3; Q59EP0; Q5UEP2; Q6T930; Q7RTM7; B3KQS2; B7Z308; B7Z4M0; F5H774

UniProt Related Accession #

O95197

GenBank Nucleotide #

NM_006054.2

NCBI Official Full Name

reticulon-3 isoform a

NCBI Official Synonym Full Names

reticulon 3

NCBI Official Symbol

RTN3

NCBI Official Synonym Symbols

HAP; ASYIP; NSPL2; NSPLII; RTN3-A1

UniProt Protein Name

Reticulon-3

UniProt Synonym Protein Names

Homolog of ASY protein; HAP; Neuroendocrine-specific protein-like 2; NSP-like protein 2; Neuroendocrine-specific protein-like II; NSP-like protein II; NSPLII

Protein Family

Reticulon

UniProt Gene Name

RTN3

UniProt Synonym Gene Names

ASYIP; NSPL2; HAP; NSP-like protein 2; NSP-like protein II; NSPLII

UniProt Entry Name

RTN3_HUMAN

NCBI Protein Information

reticulon-3; NSP-like protein 2; NSP-like protein II; homolog of ASY protein; ASY interacting protein; neuroendocrine-specific protein-like 2; neuroendocrine-specific protein-like II

NCBI Summary for RTN3

This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. [provided by RefSeq, May 2012]

UniProt Comments for RTN3

RTN3: May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Biological Process: vesicle-mediated transport; viral reproduction; apoptosis

Research Articles on RTN3

1. This study demonistrated that Reduction of beta-amyloid accumulation by reticulon 3.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-RTN3 antibody

Disease Name	Pubmed Publications
Nervous System Diseases Antibodies	>23 publications with RTN3 and Nervous System Diseases
Brain Diseases Antibodies	>20 publications with RTN3 and Brain Diseases
Necrosis Antibodies	>3 publications with RTN3 and Necrosis
Liver Diseases Antibodies	>2 publications with RTN3 and Liver Diseases
Cognition Disorders Antibodies	>2 publications with RTN3 and Cognition Disorders
Anemia Antibodies	>1 publications with RTN3 and Anemia
Movement Disorders Antibodies	>1 publications with RTN3 and Movement Disorders
Memory Disorders Antibodies	>1 publications with RTN3 and Memory Disorders
Atrophy Antibodies	>1 publications with RTN3 and Atrophy
Nerve Degeneration Antibodies	>1 publications with RTN3 and Nerve Degeneration

Organs/Tissues associated with anti-RTN3 antibody

Organ/Tissue Name	Pubmed Publications
Nerve Antibodies	>57 publications with RTN3 and Nerve
Brain Antibodies	>29 publications with RTN3 and Brain
Blood Antibodies	>4 publications with RTN3 and Blood
Liver Antibodies	>2 publications with RTN3 and Liver
Embryonic Tissue Antibodies	>2 publications with RTN3 and Embryonic Tissue
Eye Antibodies	>2 publications with RTN3 and Eye
Kidney Antibodies	>2 publications with RTN3 and Kidney
Spleen Antibodies	>1 publications with RTN3 and Spleen
Thyroid Antibodies	>1 publications with RTN3 and Thyroid
Vascular Antibodies	>1 publications with RTN3 and Vascular