Rabbit Anti-SNAI1 Polyclonal Antibody – Cat# MBS6394552

Western Blot analysis of SNAI1 expression in transfected 293T cell line by SNAI1 polyclonal antibody. Lane 1: SNAI1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.

SNAI1 Antibody – Rabbit Polyclonal

Name: SNAI1 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6394552
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6394552

The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and… More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SNAI1, Polyclonal Antibody

Full Product Name

SNAI1 (SNAH, Zinc Finger Protein SNAI1, Protein Snail Homolog 1, Protein Sna) (PE)

Product Gene Name

anti-SNAI1 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human SNAI1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

29,083 Da

Chromosome Location

Chromosome: 20; NC_000020.10 (48599513..48605423). Location: 20q13.2

OMIM

604238

3D Structure

ModBase 3D Structure for O95863

Immunogen

Full length human SNAI1, aa1-264 (NP_005976.2).

Immunogen Sequence

MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR

Conjugate

Note

Preservative Free

Product Categories/Family for anti-SNAI1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

Applications Tested/Suitable for anti-SNAI1 antibody

Western Blot (WB)

Application Notes for anti-SNAI1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SNAI1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SNAI1 purchase

MBS6394552 is an antibody targeting SNAI1. Also known as SNAI1 (SNAH, Zinc Finger Protein SNAI1, Protein Snail Homolog 1, Protein Sna) (PE). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for SNAI1. It may not necessarily be applicable to this product.

NCBI GI #

18765741

NCBI GeneID

6615

NCBI Accession #

NP_005976.2

UniProt Primary Accession #

O95863

UniProt Secondary Accession #

Q9P113; Q9UBP7; Q9UHH7; B2R842

UniProt Related Accession #

O95863

GenBank Nucleotide #

NM_005985

NCBI Official Full Name

zinc finger protein SNAI1

NCBI Official Synonym Full Names

snail family zinc finger 1

NCBI Official Symbol

SNAI1

NCBI Official Synonym Symbols

SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1

UniProt Protein Name

Zinc finger protein SNAI1

UniProt Synonym Protein Names

Protein snail homolog 1

Protein Family

Protein snail

UniProt Gene Name

SNAI1

UniProt Synonym Gene Names

SNAH; Protein sna

UniProt Entry Name

SNAI1_HUMAN

NCBI Protein Information

zinc finger protein SNAI1; protein sna; snail 1 homolog; snail homolog 1; protein snail homolog 1; snail 1 zinc finger protein; snail 1, zinc finger protein

UniProt Comments for SNAI1

Snail1: a protein of the C2H2-type zinc-finger family that regulates transcription. Involved in embryonic mesoderm formation. Plays a role in the epithelial to mesenchymal transition (EMT). EMT is characterized by decreased levels of the epithelial markers E-cadherin and alpha- and beta-catenin, and increased cellular migration and expression of the mesenchymal markers fibronectin, vimentin, N-cadherin and smooth muscle alpha-actin.E Snail binds to 3 E-boxes of the E-cadherin gene promoter and represses its transcription. NF-kappaB binds and regulates the snail promoter and is critical for EMT, and inhibition of NF-kappaB activity lowered snail levels and morphologically reversed the EMT.

Protein type: Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; metal ion binding; kinase binding

Biological Process: osteoblast differentiation; negative regulation of DNA damage response, signal transduction by p53 class mediator; cell migration; hair follicle morphogenesis; mesoderm formation; positive regulation of transcription, DNA-dependent; epithelial to mesenchymal transition; negative regulation of transcription from RNA polymerase II promoter; palate development; positive regulation of cell migration

Research Articles on SNAI1

1. Down-regulation of MTA3 and up-regulation of CGB5 and Snail are associated with preeclampsia.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-SNAI1 antibody

Products by Pathway	Pathway Diagram
Adherens Junction Pathway antibodies	Adherens Junction Pathway Diagram
Adherens Junction Pathway antibodies	Adherens Junction Pathway Diagram
Neural Crest Differentiation Pathway antibodies	Neural Crest Differentiation Pathway Diagram
Signaling Events Mediated By Hepatocyte Growth Factor Receptor (c-Met) Pathway antibodies	Signaling Events Mediated By Hepatocyte Growth Factor Receptor (c-Met) Pathway Diagram
Validated Targets Of C-MYC Transcriptional Activation Pathway antibodies	Validated Targets Of C-MYC Transcriptional Activation Pathway Diagram

Diseases associated with anti-SNAI1 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>71 publications with SNAI1 and Neoplasms
Neoplasm Invasiveness Antibodies	>27 publications with SNAI1 and Neoplasm Invasiveness
Breast Neoplasms Antibodies	>23 publications with SNAI1 and Breast Neoplasms
Neoplasm Metastasis Antibodies	>22 publications with SNAI1 and Neoplasm Metastasis
Lung Neoplasms Antibodies	>16 publications with SNAI1 and Lung Neoplasms
Lung Diseases Antibodies	>15 publications with SNAI1 and Lung Diseases
Disease Models, Animal Antibodies	>9 publications with SNAI1 and Disease Models, Animal
Carcinoma, Squamous Cell Antibodies	>9 publications with SNAI1 and Carcinoma, Squamous Cell
Cell Transformation, Neoplastic Antibodies	>7 publications with SNAI1 and Cell Transformation, Neoplastic
Melanoma Antibodies	>7 publications with SNAI1 and Melanoma

Organs/Tissues associated with anti-SNAI1 antibody

Organ/Tissue Name	Pubmed Publications
Lung Antibodies	>27 publications with SNAI1 and Lung
Embryonic Tissue Antibodies	>23 publications with SNAI1 and Embryonic Tissue
Bone Antibodies	>14 publications with SNAI1 and Bone
Skin Antibodies	>9 publications with SNAI1 and Skin
Vascular Antibodies	>9 publications with SNAI1 and Vascular
Brain Antibodies	>6 publications with SNAI1 and Brain
Blood Antibodies	>5 publications with SNAI1 and Blood
Pancreas Antibodies	>5 publications with SNAI1 and Pancreas
Kidney Antibodies	>4 publications with SNAI1 and Kidney
Intestine Antibodies	>3 publications with SNAI1 and Intestine