Rabbit Anti-TRIB2 Polyclonal Antibody – Cat# MBS6397151

Western Blot analysis of TRIB2 expression in transfected 293T cell line by TRIB2 polyclonal antibody. Lane 1: TRIB2 transfected lysate (38.8kD). Lane 2: Non-transfected lysate.

TRIB2 Antibody – Rabbit Polyclonal

Name: TRIB2 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6397151
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6397151

MBS6397151 is an antibody targeting TRIB2. Also known as TRIB2 (Tribbles Homolog 2, TRB2, TRB-2, C5FW, GS3955) (Biotin). Reactive in Human. Host: Rabbit. More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

TRIB2, Polyclonal Antibody

Full Product Name

TRIB2 (Tribbles Homolog 2, TRB2, TRB-2, C5FW, GS3955) (Biotin)

Product Gene Name

anti-TRIB2 antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human TRIB2.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunogen

Full length human TRIB2, aa1-343 (NP_067675.1).

Immunogen Sequence

MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

Conjugate

Biotin

Note

Preservative Free

Product Categories/Family for anti-TRIB2 antibody

Antibodies; Protein Kinases

Applications Tested/Suitable for anti-TRIB2 antibody

Western Blot (WB)

Application Notes for anti-TRIB2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-TRIB2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TRIB2. It may not necessarily be applicable to this product.

NCBI GI #

11056053

NCBI GeneID

28951

NCBI Accession #

NM_021643.1

UniProt Related Accession #

Q92519

GenBank Nucleotide #

NM_021643.1

NCBI Official Full Name

Homo sapiens tribbles homolog 2 (Drosophila) (TRIB2), mRNA

NCBI Official Synonym Full Names

tribbles pseudokinase 2

NCBI Official Symbol

TRIB2

NCBI Official Synonym Symbols

C5FW; TRB2; GS3955

Protein Family

Tribbles

NCBI Protein Information

tribbles homolog 2

NCBI Summary for TRIB2

This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]

Research Articles on TRIB2

1. Knockdown of circ_0084043 suppressed the malignant development of melanoma presumably through modulating miR429/TRIB2 axis and inactivating Wnt/beta-catenin signaling pathway

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.