Rabbit Anti-AMOTL2 Polyclonal Antibody – Cat# MBS9140976

Western blot-AMOTL2 Polyclonal Antibody

AMOTL2 Antibody – Rabbit Polyclonal

Name: AMOTL2 Antibody; Polyclonal; Rabbit; Human/Mouse-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS9140976
Price: 225 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS9140976

Angiomotin is a protein that binds angiostatin, a circulating inhibitor of the formation of new blood vessels (angiogenesis). Angiomotin mediates angiostatin inhibition of endothelial cell migration and tube formation in vitro. The protein encoded by this… More details

$225 / 0.02 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

AMOTL2, Polyclonal Antibody

Full Product Name

AMOTL2 Polyclonal Antibody

Product Gene Name

anti-AMOTL2 antibody

Product Synonym Names

AMOTL2; LCCP; angiomotin like 2

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human, Mouse

Form/Format

PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Purity/Purification

Affinity Purification

Concentration

1.39 mg/ml (lot specific)

Preparation and Storage

Store at -20 degree C. Avoid freeze/thaw cycles.

Molecular Weight

60kDa; 86kDa

OMIM

AB023206 mRNA

3D Structure

ModBase 3D Structure for Q9Y2J4

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 638-837 of human AMOTL2 (NP_001265612.1).

Immunogen Sequence

RQFAMDAAATAAAQRDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI

ISO Certification

Manufactured in an ISO 9001:2015 Certified Laboratory.

Applications Tested/Suitable for anti-AMOTL2 antibody

Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)

Application Notes for anti-AMOTL2 antibody

WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100

Other Notes

Small volumes of anti-AMOTL2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AMOTL2 purchase

MBS9140976 is an antibody targeting AMOTL2. Also known as AMOTL2 Polyclonal Antibody. Reactive in Human, Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for AMOTL2. It may not necessarily be applicable to this product.

NCBI GI #

522838240

NCBI GeneID

51421

NCBI Accession #

NP_001265612.1

UniProt Primary Accession #

Q9Y2J4

UniProt Related Accession #

Q9Y2J4

GenBank Nucleotide #

NP_001265612.1

NCBI Official Full Name

angiomotin-like protein 2 isoform 1

NCBI Official Synonym Full Names

angiomotin like 2

NCBI Official Symbol

AMOTL2

NCBI Official Synonym Symbols

LCCP

UniProt Protein Name

Angiomotin-like protein 2

UniProt Synonym Protein Names

Leman coiled-coil protein; LCCP

Protein Family

Angiomotin-like protein

UniProt Gene Name

AMOTL2

UniProt Synonym Gene Names

KIAA0989; LCCP

NCBI Protein Information

angiomotin-like protein 2

UniProt Comments for AMOTL2

AMOTL2: Regulates the translocation of phosphorylated SRC to peripheral cell-matrix adhesion sites. Required for proper architecture of actin filaments. Inhibits the Wnt/beta-catenin signaling pathway, probably by recruiting CTNNB1 to recycling endosomes and hence preventing its translocation to the nucleus. Participates in angiogenesis. May play a role in the polarity, proliferation and migration of endothelial cells. Selectively promotes FGF-induced MAPK activation through SRC. Belongs to the angiomotin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion

Chromosomal Location of Human Ortholog: 3q22.2

Cellular Component: apical plasma membrane; bicellular tight junction; cytosol; recycling endosome

Molecular Function: identical protein binding; protein binding

Biological Process: Wnt signaling pathway

Research Articles on AMOTL2

1. these results provide novel insights into a dual tumor suppressive function of AMOTL2 by targeting both YAP and AKT in liver size control and cancer prevention

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-AMOTL2 antibody

Products by Pathway	Pathway Diagram
Signal Transduction Pathway antibodies	Signal Transduction Pathway Diagram
Signaling By Hippo Pathway antibodies	Signaling By Hippo Pathway Diagram

Diseases associated with anti-AMOTL2 antibody

Disease Name	Pubmed Publications
Breast Neoplasms Antibodies	>1 publications with AMOTL2 and Breast Neoplasms

Organs/Tissues associated with anti-AMOTL2 antibody

Organ/Tissue Name	Pubmed Publications
Vascular Antibodies	>3 publications with AMOTL2 and Vascular
Kidney Antibodies	>2 publications with AMOTL2 and Kidney
Eye Antibodies	>1 publications with AMOTL2 and Eye