• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

COMT Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6374422

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways… More details

$1165 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
COMT, Polyclonal Antibody
Full Product Name
COMT (Catechol-O-Methyltransferase) (PE)
Product Gene Name
anti-COMT antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human COMT. Species Crossreactivity: mouse.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
24,449 Da
OMIM
103780
3D Structure
ModBase 3D Structure for P21964
Immunogen
Full length human COMT, aa1-221 (NP_009294.1).
Immunogen Sequence
MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Conjugate
PE
Note
Preservative Free

Product Categories/Family for anti-COMT antibody

Antibodies; Enzymes; Methyltransferase
Applications Tested/Suitable for anti-COMT antibody
Western Blot (WB)
Application Notes for anti-COMT antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-COMT antibody

COMT rabbit polyclonal antibody. Western Blot analysis of COMT expression in mouse liver.
Rabbit Anti-COMT Polyclonal Antibody – Cat# MBS6374422

Western Blot (WB) of anti-COMT antibody

Western Blot analysis of COMT expression in transfected 293T cell line by COMT polyclonal antibody. Lane 1: COMT transfected lysate (24.4kD). Lane 2: Non-transfected lysate.
Rabbit Anti-COMT Polyclonal Antibody, Western Blot (WB) – Cat# MBS6374422

Other Notes

Small volumes of anti-COMT antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for COMT purchase

MBS6374422 is an antibody targeting COMT. Also known as COMT (Catechol-O-Methyltransferase) (PE). Reactive in Human, Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for COMT. It may not necessarily be applicable to this product.

NCBI GI #
6466450
NCBI GeneID
1312
NCBI Accession #
NP_009294.1
UniProt Primary Accession #
P21964
UniProt Secondary Accession #
Q6IB07; Q6ICE6; Q9BWC7; A8MPV9
UniProt Related Accession #
P21964
GenBank Nucleotide #
NM_007310.1
NCBI Official Full Name
catechol O-methyltransferase isoform S-COMT
NCBI Official Synonym Full Names
catechol-O-methyltransferase
NCBI Official Symbol
COMT
NCBI Official Synonym Symbols
HEL-S-98n
UniProt Protein Name
Catechol O-methyltransferase
Protein Family
Catechol O-methyltransferase
UniProt Gene Name
COMT
UniProt Entry Name
COMT_HUMAN
NCBI Protein Information
catechol O-methyltransferase; epididymis secretory sperm binding protein Li 98n

UniProt Comments for COMT

COMT: Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. Belongs to the mammalian catechol-O-methyltransferase family. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Methyltransferase; Membrane protein, integral; EC 2.1.1.6; Amino Acid Metabolism - tyrosine

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: postsynaptic membrane; mitochondrion; membrane; axon; plasma membrane; integral to membrane; dendritic spine; cytosol

Molecular Function: protein binding; magnesium ion binding; O-methyltransferase activity; catechol O-methyltransferase activity

Biological Process: response to drug; methylation; estrogen metabolic process; cellular response to phosphate starvation; neurotransmitter catabolic process; dopamine catabolic process; negative regulation of smooth muscle cell proliferation; short-term memory; response to pain; response to lipopolysaccharide; learning; female pregnancy; reproductive process in a multicellular organism; response to organic cyclic substance; positive regulation of homocysteine metabolic process; negative regulation of dopamine metabolic process; synaptic transmission; xenobiotic metabolic process; regulation of sensory perception of pain; developmental process; neurotransmitter biosynthetic process

Disease: Schizophrenia; Panic Disorder 1
Show more

Research Articles on COMT

1. Age-related differences were qualified by an interaction with COMT genotype (P < .001), and this interaction was due to decreased behavioral plasticity in older adults carrying the Val/Val genotype

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-COMT antibody

 Reference Product  PubMed Publications
 CYP1B1 antibody  >124 publications with COMT and CYP1B1
 CYP1A1 antibody  >110 publications with COMT and CYP1A1
 MAOA antibody  >92 publications with COMT and MAOA
 DBH antibody  >77 publications with COMT and DBH
 DDC antibody  >31 publications with COMT and DDC
 MAOB antibody  >30 publications with COMT and MAOB
 PNMT antibody  >29 publications with COMT and PNMT
 UGT1A1 antibody  >13 publications with COMT and UGT1A1
 UGT1A9 antibody  >4 publications with COMT and UGT1A9
 UGT1A8 antibody  >3 publications with COMT and UGT1A8

Pathways associated with anti-COMT antibody

 Products by Pathway  Pathway Diagram
 Biogenic Amine Synthesis Pathway antibodies  Biogenic Amine Synthesis Pathway Diagram
 Biological Oxidations Pathway antibodies  Biological Oxidations Pathway Diagram
 Defective AHCY Causes Hypermethioninemia With S-adenosylhomocysteine Hydrolase Deficiency (HMAHCHD) Pathway antibodies  Defective AHCY Causes Hypermethioninemia With S-adenosylhomocysteine Hydrolase Deficiency (HMAHCHD) Pathway Diagram
 Defective GCLC Causes Hemolytic Anemia Due To Gamma-glutamylcysteine Synthetase Deficiency (HAGGSD) Pathway antibodies  Defective GCLC Causes Hemolytic Anemia Due To Gamma-glutamylcysteine Synthetase Deficiency (HAGGSD) Pathway Diagram
 Defective GGT1 Causes Glutathionuria (GLUTH) Pathway antibodies  Defective GGT1 Causes Glutathionuria (GLUTH) Pathway Diagram
 Defective GSS Causes Glutathione Synthetase Deficiency (GSS Deficiency) Pathway antibodies  Defective GSS Causes Glutathione Synthetase Deficiency (GSS Deficiency) Pathway Diagram
 Defective MAT1A Causes Methionine Adenosyltransferase Deficiency (MATD) Pathway antibodies  Defective MAT1A Causes Methionine Adenosyltransferase Deficiency (MATD) Pathway Diagram
 Defective OPLAH Causes 5-oxoprolinase Deficiency (OPLAHD) Pathway antibodies  Defective OPLAH Causes 5-oxoprolinase Deficiency (OPLAHD) Pathway Diagram
 Defective SLC35D1 Causes Schneckenbecken Dysplasia (SCHBCKD) Pathway antibodies  Defective SLC35D1 Causes Schneckenbecken Dysplasia (SCHBCKD) Pathway Diagram
 Defective TPMT Causes Thiopurine S-methyltransferase Deficiency (TPMT Deficiency) Pathway antibodies  Defective TPMT Causes Thiopurine S-methyltransferase Deficiency (TPMT Deficiency) Pathway Diagram

Diseases associated with anti-COMT antibody

 Disease Name  Pubmed Publications
 Mental Disorders Antibodies  >1023 publications with COMT and Mental Disorders
 Nervous System Diseases Antibodies  >659 publications with COMT and Nervous System Diseases
 Schizophrenia Antibodies  >503 publications with COMT and Schizophrenia
 Movement Disorders Antibodies  >410 publications with COMT and Movement Disorders
 Parkinson Disease Antibodies  >375 publications with COMT and Parkinson Disease
 Pain Antibodies  >164 publications with COMT and Pain
 Cognition Disorders Antibodies  >163 publications with COMT and Cognition Disorders
 Breast Neoplasms Antibodies  >158 publications with COMT and Breast Neoplasms
 Cardiovascular Diseases Antibodies  >148 publications with COMT and Cardiovascular Diseases
 Bipolar Disorder Antibodies  >120 publications with COMT and Bipolar Disorder

Organs/Tissues associated with anti-COMT antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >1088 publications with COMT and Brain
 Blood Antibodies  >670 publications with COMT and Blood
 Liver Antibodies  >260 publications with COMT and Liver
 Nerve Antibodies  >148 publications with COMT and Nerve
 Heart Antibodies  >135 publications with COMT and Heart
 Muscle Antibodies  >134 publications with COMT and Muscle
 Vascular Antibodies  >122 publications with COMT and Vascular
 Kidney Antibodies  >104 publications with COMT and Kidney
 Lung Antibodies  >49 publications with COMT and Lung
 Intestine Antibodies  >40 publications with COMT and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000