• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CXCL11 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6375184

Chemokines are a group of small (approximately 8 to 14kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors.… More details

$1165 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CXCL11, Polyclonal Antibody
Full Product Name
CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (Biotin)
Product Gene Name
anti-CXCL11 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CXCL11. Species Crossreactivity: mouse.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
10,365 Da
Chromosome Location
Chromosome: 4; NC_000004.11 (76954835..76957350, complement). Location: 4q21.2
OMIM
604852
3D Structure
ModBase 3D Structure for O14625
Immunogen
Full length human CXCL11, aa1-94 (NP_005400.1).
Immunogen Sequence
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Conjugate
Biotin
Note
Preservative Free

Product Categories/Family for anti-CXCL11 antibody

MB-Antibodies; Growth Factors; CXCL
Applications Tested/Suitable for anti-CXCL11 antibody
Western Blot (WB)
Application Notes for anti-CXCL11 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CXCL11 antibody

CXCL11 rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in Jurkat.
Rabbit Anti-CXCL11 Polyclonal Antibody – Cat# MBS6375184

Western Blot (WB) of anti-CXCL11 antibody

CXCL11 rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in NIH/3T3.
Rabbit Anti-CXCL11 Polyclonal Antibody, Western Blot (WB) – Cat# MBS6375184

Western Blot (WB) of anti-CXCL11 antibody

Western Blot analysis of CXCL11 expression in transfected 293T cell line by CXCL11 polyclonal antibody. Lane 1: CXCL11 transfected lysate (10.4kD). Lane 2: Non-transfected lysate.
Rabbit Anti-CXCL11 Polyclonal Antibody, Western Blot (WB) – Cat# MBS6375184

Other Notes

Small volumes of anti-CXCL11 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CXCL11 purchase

MBS6375184 is an antibody targeting CXCL11. Also known as CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (Biotin). Reactive in Human, Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for CXCL11. It may not necessarily be applicable to this product.

NCBI GI #
4885589
NCBI GeneID
6373
NCBI Accession #
NP_005400.1
UniProt Primary Accession #
O14625
UniProt Secondary Accession #
Q53YA3; Q92840
UniProt Related Accession #
O14625
GenBank Nucleotide #
NM_005409
NCBI Official Full Name
C-X-C motif chemokine 11
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 11
NCBI Official Symbol
CXCL11
NCBI Official Synonym Symbols
IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
UniProt Protein Name
C-X-C motif chemokine 11
UniProt Synonym Protein Names
Beta-R1; H174; Interferon gamma-inducible protein 9; IP-9; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Small-inducible cytokine B11
Protein Family
C-X-C motif chemokine
UniProt Gene Name
CXCL11
UniProt Synonym Gene Names
ITAC; SCYB11; SCYB9B; IP-9; I-TAC
UniProt Entry Name
CXL11_HUMAN
NCBI Protein Information
C-X-C motif chemokine 11; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small indu

UniProt Comments for CXCL11

CXCL11: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Chemokine; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21.2

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; protein binding; CXCR3 chemokine receptor binding; chemokine activity

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; immune response; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of cAMP metabolic process; signal transduction; chemotaxis; inflammatory response; regulation of cell proliferation
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CXCL11 antibody

 Reference Product  PubMed Publications
 CXCL10 antibody  >456 publications with CXCL11 and CXCL10
 CXCL9 antibody  >362 publications with CXCL11 and CXCL9
 CXCR3 antibody  >304 publications with CXCL11 and CXCR3
 CCL5 antibody  >87 publications with CXCL11 and CCL5
 CXCR7 antibody  >40 publications with CXCL11 and CXCR7
 CCR5 antibody  >37 publications with CXCL11 and CCR5
 CXCL13 antibody  >14 publications with CXCL11 and CXCL13
 CXCL6 antibody  >10 publications with CXCL11 and CXCL6
 CCR3 antibody  >10 publications with CXCL11 and CCR3
 PF4 antibody  >6 publications with CXCL11 and PF4

Pathways associated with anti-CXCL11 antibody

 Products by Pathway  Pathway Diagram
 CXCR3-mediated Signaling Events Pathway antibodies  CXCR3-mediated Signaling Events Pathway Diagram
 Chemokine Receptors Bind Chemokines Pathway antibodies  Chemokine Receptors Bind Chemokines Pathway Diagram
 Chemokine Signaling Pathway antibodies  Chemokine Signaling Pathway Diagram
 Chemokine Signaling Pathway antibodies  Chemokine Signaling Pathway Diagram
 Class A/1 (Rhodopsin-like Receptors) Pathway antibodies  Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 G Alpha (i) Signalling Events Pathway antibodies  G Alpha (i) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram

Diseases associated with anti-CXCL11 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >186 publications with CXCL11 and Inflammation
 Necrosis Antibodies  >80 publications with CXCL11 and Necrosis
 Lung Diseases Antibodies  >61 publications with CXCL11 and Lung Diseases
 Disease Models, Animal Antibodies  >55 publications with CXCL11 and Disease Models, Animal
 Liver Diseases Antibodies  >35 publications with CXCL11 and Liver Diseases
 Cardiovascular Diseases Antibodies  >30 publications with CXCL11 and Cardiovascular Diseases
 Fibrosis Antibodies  >28 publications with CXCL11 and Fibrosis
 Death Antibodies  >22 publications with CXCL11 and Death
 Kidney Diseases Antibodies  >22 publications with CXCL11 and Kidney Diseases
 Adenocarcinoma Antibodies  >19 publications with CXCL11 and Adenocarcinoma

Organs/Tissues associated with anti-CXCL11 antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >83 publications with CXCL11 and Lung
 Vascular Antibodies  >77 publications with CXCL11 and Vascular
 Skin Antibodies  >51 publications with CXCL11 and Skin
 Liver Antibodies  >44 publications with CXCL11 and Liver
 Muscle Antibodies  >29 publications with CXCL11 and Muscle
 Intestine Antibodies  >27 publications with CXCL11 and Intestine
 Bone Marrow Antibodies  >22 publications with CXCL11 and Bone Marrow
 Mouth Antibodies  >13 publications with CXCL11 and Mouth
 Uterus Antibodies  >9 publications with CXCL11 and Uterus
 Connective Tissue Antibodies  >4 publications with CXCL11 and Connective Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000