• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NDUFS3 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6386734

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The… More details

$1165 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NDUFS3, Polyclonal Antibody
Full Product Name
NDUFS3 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 3, Mitochondrial, Complex I-30kD, CI-30kD, NADH-ubiquinone Oxidoreductase 30kD Subunit) (Biotin)
Product Gene Name
anti-NDUFS3 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NDUFS3. Species Crossreactivity: mouse.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
30,242 Da
Chromosome Location
Chromosome: 11; NC_000011.9 (47600562..47606115). Location: 11p11.11
OMIM
603846
3D Structure
ModBase 3D Structure for O75489
Immunogen
Full length human NDUFS3, aa1-264 (NP_004542.1).
Immunogen Sequence
MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Conjugate
Biotin
Note
Preservative Free

Product Categories/Family for anti-NDUFS3 antibody

Antibodies; Enzymes; Dehydrogenase
Applications Tested/Suitable for anti-NDUFS3 antibody
Western Blot (WB)
Application Notes for anti-NDUFS3 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-NDUFS3 antibody

NDUFS3 rabbit polyclonal antibody. Western Blot analysis of NDUFS3 expression in human pancreas
Rabbit Anti-NDUFS3 Polyclonal Antibody – Cat# MBS6386734

Western Blot (WB) of anti-NDUFS3 antibody

NDUFS3 rabbit polyclonal antibody. Western Blot analysis of NDUFS3 expression in mouse kidney.
Rabbit Anti-NDUFS3 Polyclonal Antibody, Western Blot (WB) – Cat# MBS6386734

Western Blot (WB) of anti-NDUFS3 antibody

NDUFS3 rabbit polyclonal antibody. Western Blot analysis of NDUFS3 expression in HepG2.
Rabbit Anti-NDUFS3 Polyclonal Antibody, Western Blot (WB) – Cat# MBS6386734

Western Blot (WB) of anti-NDUFS3 antibody

Western Blot analysis of NDUFS3 expression in transfected 293T cell line by NDUFS3 polyclonal antibody. Lane 1: NDUFS3 transfected lysate (30.2kD). Lane 2: Non-transfected lysate.
Rabbit Anti-NDUFS3 Polyclonal Antibody, Western Blot (WB) – Cat# MBS6386734

Other Notes

Small volumes of anti-NDUFS3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NDUFS3 purchase

MBS6386734 is an antibody targeting NDUFS3. Also known as NDUFS3 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 3, Mitochondrial, Complex I-30kD, CI-30kD, NADH-ubiquinone Oxidoreductase 30kD Subunit) (Biotin). Reactive in Human, Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for NDUFS3. It may not necessarily be applicable to this product.

NCBI GI #
4758788
NCBI GeneID
4722
NCBI Accession #
NP_004542.1
UniProt Primary Accession #
O75489
UniProt Secondary Accession #
Q9UNQ8; B2R9J1
UniProt Related Accession #
O75489
GenBank Nucleotide #
NM_004551.1
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
NCBI Official Symbol
NDUFS3
NCBI Official Synonym Symbols
CI-30
UniProt Protein Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
UniProt Synonym Protein Names
Complex I-30kD; CI-30kD; NADH-ubiquinone oxidoreductase 30 kDa subunit
UniProt Gene Name
NDUFS3
UniProt Synonym Gene Names
CI-30kD
UniProt Entry Name
NDUS3_HUMAN
NCBI Protein Information
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial; NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial; CI-30kD; complex I-30kD; complex I 30kDa subunit; NADH dehydrogenase-ubiquinone 30 kDa subunit; NADH-ubiquinone oxi

NCBI Summary for NDUFS3

This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.[provided by RefSeq, Apr 2009]

UniProt Comments for NDUFS3

NDUFS3: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I 30 kDa subunit family.

Protein type: Oxidoreductase; EC 1.6.99.3; EC 1.6.5.3; Mitochondrial; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 11p11.11

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial membrane; nucleus; mitochondrial respiratory chain complex I

Molecular Function: protein binding; NADH dehydrogenase (ubiquinone) activity; electron carrier activity; NADH dehydrogenase activity

Biological Process: cellular metabolic process; substantia nigra development; mitochondrial electron transport, NADH to ubiquinone; negative regulation of cell growth

Disease: Leigh Syndrome; Mitochondrial Complex I Deficiency
Show more

Research Articles on NDUFS3

1. a novel, biomarker potential of a mitochondrial complex I subunit protein, NDUFS3 - as a robust indicator of breast cancer progression and invasiveness as well as of hypoxia/necrosis in clinical specimens of invasive ductal carcinoma, was uncovered.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-NDUFS3 antibody

 Products by Pathway  Pathway Diagram
 3-phosphoinositide Degradation Pathway antibodies  3-phosphoinositide Degradation Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Electron Transport Chain Pathway antibodies  Electron Transport Chain Pathway Diagram
 Huntington's Disease Pathway antibodies  Huntington's Disease Pathway Diagram
 Huntington's Disease Pathway antibodies  Huntington's Disease Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 NADH Dehydrogenase (ubiquinone) Fe-S Protein/flavoprotein Complex, Mitochondria Pathway antibodies  NADH Dehydrogenase (ubiquinone) Fe-S Protein/flavoprotein Complex, Mitochondria Pathway Diagram
 Oxidative Phosphorylation Pathway antibodies  Oxidative Phosphorylation Pathway Diagram
 Oxidative Phosphorylation Pathway antibodies  Oxidative Phosphorylation Pathway Diagram

Diseases associated with anti-NDUFS3 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >11 publications with NDUFS3 and Neoplasms
 Death Antibodies  >9 publications with NDUFS3 and Death
 Nervous System Diseases Antibodies  >6 publications with NDUFS3 and Nervous System Diseases
 Brain Diseases Antibodies  >5 publications with NDUFS3 and Brain Diseases
 Diabetes Mellitus Antibodies  >4 publications with NDUFS3 and Diabetes Mellitus
 Breast Neoplasms Antibodies  >4 publications with NDUFS3 and Breast Neoplasms
 Drug Toxicity Antibodies  >3 publications with NDUFS3 and Drug Toxicity
 Kidney Diseases Antibodies  >3 publications with NDUFS3 and Kidney Diseases
 Inflammation Antibodies  >1 publications with NDUFS3 and Inflammation
 Necrosis Antibodies  >1 publications with NDUFS3 and Necrosis

Organs/Tissues associated with anti-NDUFS3 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >7 publications with NDUFS3 and Blood
 Kidney Antibodies  >6 publications with NDUFS3 and Kidney
 Brain Antibodies  >5 publications with NDUFS3 and Brain
 Muscle Antibodies  >2 publications with NDUFS3 and Muscle
 Embryonic Tissue Antibodies  >2 publications with NDUFS3 and Embryonic Tissue
 Adipose Tissue Antibodies  >1 publications with NDUFS3 and Adipose Tissue
 Heart Antibodies  >1 publications with NDUFS3 and Heart
 Connective Tissue Antibodies  >1 publications with NDUFS3 and Connective Tissue
 Liver Antibodies  >1 publications with NDUFS3 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000