• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HNRNPD Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Special Promotion Catalog #: MBS9140420
SPECIAL PROMOTION: Get FREE $5 Amazon gift card (Maximum 5 gift cards/product). Gift card(s) will be included with shipment

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs… More details

$225 / 0.02 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HNRNPD, Polyclonal Antibody
Full Product Name
HNRNPD Polyclonal Antibody
Product Gene Name
anti-HNRNPD antibody
Product Synonym Names
HNRNPD; AUF1; AUF1A; HNRPD; P37; hnRNPD0; heterogeneous nuclear ribonucleoprotein D
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Purity/Purification
Affinity Purification
Concentration
1.75 mg/ml (lot specific)
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Molecular Weight
Calculated: 30kDa; 32kDa; 36kDa; 38kDa
Observed: 37-45kDa
OMIM
601324
3D Structure
ModBase 3D Structure for Q14103
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human HNRNPD (NP_002129.2).
Immunogen Sequence
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY
Positive Samples
HeLa, Jurkat, HepG2, Mouse Brain, Rat Brain
Cellular Location
Cytoplasm, Nucleus
ISO Certification
Manufactured in an ISO 9001:2015 Certified Laboratory.
Applications Tested/Suitable for anti-HNRNPD antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes for anti-HNRNPD antibody
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200

Western Blot (WB) of anti-HNRNPD antibody

Western blot-HNRNPD Polyclonal Antibody
Rabbit Anti-HNRNPD Polyclonal Antibody – Cat# MBS9140420

Immunohistochemistry (IHC) of anti-HNRNPD antibody

Immunohistochemistry-HNRNPD Polyclonal Antibody
Rabbit Anti-HNRNPD Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS9140420

Immunohistochemistry (IHC) of anti-HNRNPD antibody

Immunohistochemistry-HNRNPD Polyclonal Antibody
Rabbit Anti-HNRNPD Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS9140420

Immunohistochemistry (IHC) of anti-HNRNPD antibody

Immunohistochemistry-HNRNPD Polyclonal Antibody
Rabbit Anti-HNRNPD Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS9140420

Immunofluorescence (IF) of anti-HNRNPD antibody

Immunofluorescence-HNRNPD Polyclonal Antibody
Rabbit Anti-HNRNPD Polyclonal Antibody, Immunofluorescence (IF) – Cat# MBS9140420

Immunofluorescence (IF) of anti-HNRNPD antibody

Immunofluorescence-HNRNPD Polyclonal Antibody
Rabbit Anti-HNRNPD Polyclonal Antibody, Immunofluorescence (IF) – Cat# MBS9140420

Immunofluorescence (IF) of anti-HNRNPD antibody

Immunofluorescence-HNRNPD Polyclonal Antibody
Rabbit Anti-HNRNPD Polyclonal Antibody, Immunofluorescence (IF) – Cat# MBS9140420

Immunofluorescence (IF) of anti-HNRNPD antibody

Immunofluorescence-HNRNPD Polyclonal Antibody
Rabbit Anti-HNRNPD Polyclonal Antibody, Immunofluorescence (IF) – Cat# MBS9140420

Other Notes

Small volumes of anti-HNRNPD antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HNRNPD purchase

MBS9140420 is an antibody targeting HNRNPD. Also known as HNRNPD Polyclonal Antibody. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for HNRNPD. It may not necessarily be applicable to this product.

NCBI GI #
51477708
NCBI GeneID
3184
NCBI Accession #
NP_001003810.1
UniProt Primary Accession #
Q14103
UniProt Related Accession #
Q14103
GenBank Nucleotide #
NP_001003810.1
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein D0 isoform d
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein D
NCBI Official Symbol
HNRNPD
NCBI Official Synonym Symbols
P37; AUF1; AUF1A; HNRPD; hnRNPD0
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein D0
UniProt Synonym Protein Names
AU-rich element RNA-binding protein 1
Protein Family
Heterogeneous nuclear ribonucleoprotein
UniProt Gene Name
HNRNPD
UniProt Synonym Gene Names
AUF1; HNRPD; hnRNP D0
UniProt Entry Name
HNRPD_HUMAN
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein D0

UniProt Comments for HNRNPD

hnRNP D0: a ubiquitously expressed heterogeneous nuclear ribonucleoprotein (hnRNP). Implicated in the regulation of mRNA stability. Has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. Four alternatively spliced transcript variants have been described.

Protein type: RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: nucleoplasm; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; RNA binding; telomeric DNA binding; nucleotide binding

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; positive regulation of translation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; RNA splicing; RNA catabolic process; gene expression; regulation of mRNA stability; regulation of circadian rhythm
Show more

Research Articles on HNRNPD

1. Anti-apoptotic gene Bcl-2 was suppressed by berberine treatment and lncRNA CASC2, inducing the pro-apoptotic effects. Moreover, lncRNA CASC2 binds to AUF1, which sequestered AUF1 from binding to Bcl-2 mRNA, thus inducing the inactivation of Bcl-2 translation.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-HNRNPD antibody

 Products by Pathway  Pathway Diagram
 Destabilization Of MRNA By AUF1 (hnRNP D0) Pathway antibodies  Destabilization Of MRNA By AUF1 (hnRNP D0) Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Processing Of Capped Intron-Containing Pre-mRNA Pathway antibodies  Processing Of Capped Intron-Containing Pre-mRNA Pathway Diagram
 Regulation Of MRNA Stability By Proteins That Bind AU-rich Elements Pathway antibodies  Regulation Of MRNA Stability By Proteins That Bind AU-rich Elements Pathway Diagram
 MRNA Splicing Pathway antibodies  MRNA Splicing Pathway Diagram
 MRNA Splicing - Major Pathway antibodies  MRNA Splicing - Major Pathway Diagram
 MRNA Processing Pathway antibodies  MRNA Processing Pathway Diagram

Diseases associated with anti-HNRNPD antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >3 publications with HNRNPD and Neoplasms
 Necrosis Antibodies  >3 publications with HNRNPD and Necrosis
 Disease Models, Animal Antibodies  >2 publications with HNRNPD and Disease Models, Animal
 Nervous System Diseases Antibodies  >1 publications with HNRNPD and Nervous System Diseases
 Abnormalities, Multiple Antibodies  >1 publications with HNRNPD and Abnormalities, Multiple
 Neoplasms, Experimental Antibodies  >1 publications with HNRNPD and Neoplasms, Experimental
 Cell Transformation, Neoplastic Antibodies  >1 publications with HNRNPD and Cell Transformation, Neoplastic
 Congenital Abnormalities Antibodies  >1 publications with HNRNPD and Congenital Abnormalities
 Inflammation Antibodies  >1 publications with HNRNPD and Inflammation
 Death Antibodies  >1 publications with HNRNPD and Death

Organs/Tissues associated with anti-HNRNPD antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >2 publications with HNRNPD and Blood
 Skin Antibodies  >1 publications with HNRNPD and Skin
 Brain Antibodies  >1 publications with HNRNPD and Brain
 Embryonic Tissue Antibodies  >1 publications with HNRNPD and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000