• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Liver FABP (FABP) Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177779

Description: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, liver(FABP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
liver FABP, Polyclonal Antibody
Full Product Name
Anti-liver FABP Antibody
Product Gene Name
anti-FABP antibody
Product Synonym Names
Fatty acid-binding protein; FABP 1; FABP1; FABP-1; FABPL; FABPL_HUMAN; Fatty Acid Binding Protein 1; Fatty acid binding protein 1 liver; Fatty Acid Binding Protein; Fatty acid-binding protein 1; Fatty acid-binding protein; Fatty acid-binding protein liver; L FABP; L-FABP; liver; Liver-type fatty acid-binding protein; fatty acid binding protein 1, liver
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
14,208 Da
OMIM
134650
3D Structure
ModBase 3D Structure for P07148
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-FABP antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-FABP antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-FABP antibody

Anti- liver FABP Picoband antibody, MBS177779, Western blotting
All lanes: Anti liver FABP (MBS177779) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SMMC Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Lane 5: RH35 Whole Cell Lysate at 40ug
Predicted bind size: 14KD
Observed bind size: 14KD
Anti-FABP Polyclonal Antibody – Cat# MBS177779

Immunohistochemistry (IHC) of anti-FABP antibody

Anti- liver FABP Picoband antibody, MBS177779,IHC(P)
IHC(P): Mouse Intestine Tissue
Anti-FABP Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177779

Immunohistochemistry (IHC) of anti-FABP antibody

Anti- liver FABP Picoband antibody, MBS177779,IHC(P)
IHC(P): Rat Intestine Tissue
Anti-FABP Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177779

Immunohistochemistry (IHC) of anti-FABP antibody

Anti- liver FABP Picoband antibody, MBS177779,IHC(P)
IHC(P): Human Intestinal Cancer Tissue
Anti-FABP Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177779

Product References and Citations for anti-FABP antibody

1. Sparkes, R. S.; Mohandas, T.; Heinzmann, C.; Gordon, J. I.; Klisak, I.; Zollman, S.; Sweetser, D. A.; Ragunathan, L.; Winokur, S.; Lusis, A. J. : Human fatty acid binding protein assignments: intestinal to 4q28-4q31 and liver to 2p11. (Abstract) Cytogenet. Cell Genet. 46: 697 only, 1987. 2. Sweetser, D. A.; Birkenmeier, E. H.; Klisak, I. J.; Zollman, S.; Sparkes, R. S.; Mohandas, T.; Lusis, A. J.; Gordon, J. I. : The human and rodent intestinal fatty acid binding protein genes: a comparative analysis of their structure, expression, and linkage relationships. J. Biol. Chem. 262: 16060-16071, 1987.

Other Notes

Small volumes of anti-FABP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FABP purchase

MBS177779 is an antibody targeting FABP. Also known as Anti-liver FABP Antibody. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for FABP. It may not necessarily be applicable to this product.

NCBI GI #
4557577
NCBI GeneID
2168
NCBI Accession #
NP_001434.1
UniProt Primary Accession #
P07148
UniProt Related Accession #
P07148
GenBank Nucleotide #
NM_001443.2
NCBI Official Full Name
fatty acid-binding protein, liver
NCBI Official Synonym Full Names
fatty acid binding protein 1
NCBI Official Symbol
FABP1
NCBI Official Synonym Symbols
FABPL; L-FABP
UniProt Protein Name
Fatty acid-binding protein, liver
UniProt Synonym Protein Names
Fatty acid-binding protein 1; Liver-type fatty acid-binding protein; L-FABP
Protein Family
Fatty acid-binding protein
UniProt Gene Name
FABP1
UniProt Synonym Gene Names
FABPL; L-FABP
UniProt Entry Name
FABPL_HUMAN
NCBI Protein Information
fatty acid-binding protein, liver

NCBI Summary for FABP

This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]
Show more

UniProt Comments for FABP

FABP1: Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 2p11

Cellular Component: apical cortex; cytoplasm; cytosol; nucleoplasm; peroxisomal matrix

Molecular Function: antioxidant activity; bile acid binding; chromatin binding; drug binding; fatty acid binding; long-chain fatty acid transporter activity; phospholipid binding; protein binding

Biological Process: cellular lipid metabolic process; intestinal absorption; long-chain fatty acid transport; negative regulation of apoptosis; negative regulation of caspase activity; positive regulation of cell proliferation; positive regulation of defense response to virus by host; positive regulation of fatty acid beta-oxidation; positive regulation of hydrolase activity; triacylglycerol catabolic process
Show more

Research Articles on FABP

1. Higher urinary L-FABP was found in pregnant with and without gestational diabetes mellitus(GDM), and considerably higher urinary L-FABP was found in the GDM group compared with the non-GDM group.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-FABP antibody

 Products by Pathway  Pathway Diagram
 Fat Digestion And Absorption Pathway antibodies  Fat Digestion And Absorption Pathway Diagram
 Fat Digestion And Absorption Pathway antibodies  Fat Digestion And Absorption Pathway Diagram
 Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway antibodies  Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway Diagram
 Hormone-sensitive Lipase (HSL)-mediated Triacylglycerol Hydrolysis Pathway antibodies  Hormone-sensitive Lipase (HSL)-mediated Triacylglycerol Hydrolysis Pathway Diagram
 Lipid Digestion, Mobilization, And Transport Pathway antibodies  Lipid Digestion, Mobilization, And Transport Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Lipids And Lipoproteins Pathway antibodies  Metabolism Of Lipids And Lipoproteins Pathway Diagram
 PPAR Signaling Pathway antibodies  PPAR Signaling Pathway Diagram
 PPAR Signaling Pathway antibodies  PPAR Signaling Pathway Diagram
 PPARA Activates Gene Expression Pathway antibodies  PPARA Activates Gene Expression Pathway Diagram

Diseases associated with anti-FABP antibody

 Disease Name  Pubmed Publications
 Fatty Liver Antibodies  >377 publications with FABP and Fatty Liver
 Kidney Diseases Antibodies  >103 publications with FABP and Kidney Diseases
 Liver Diseases Antibodies  >84 publications with FABP and Liver Diseases
 Acute Kidney Injury Antibodies  >62 publications with FABP and Acute Kidney Injury
 Cardiovascular Diseases Antibodies  >39 publications with FABP and Cardiovascular Diseases
 Proteinuria Antibodies  >33 publications with FABP and Proteinuria
 Liver Neoplasms Antibodies  >32 publications with FABP and Liver Neoplasms
 Inflammation Antibodies  >28 publications with FABP and Inflammation
 Hypertension Antibodies  >20 publications with FABP and Hypertension
 Necrosis Antibodies  >16 publications with FABP and Necrosis

Organs/Tissues associated with anti-FABP antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >388 publications with FABP and Liver
 Kidney Antibodies  >121 publications with FABP and Kidney
 Intestine Antibodies  >100 publications with FABP and Intestine
 Muscle Antibodies  >30 publications with FABP and Muscle
 Stomach Antibodies  >12 publications with FABP and Stomach
 Embryonic Tissue Antibodies  >10 publications with FABP and Embryonic Tissue
 Lung Antibodies  >8 publications with FABP and Lung
 Placenta Antibodies  >7 publications with FABP and Placenta
 Prostate Antibodies  >3 publications with FABP and Prostate
 Mammary Gland Antibodies  >1 publications with FABP and Mammary Gland
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000