• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RAD51 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751209

Description: Rabbit IgG polyclonal antibody for Rad51 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: DNA repair protein RAD51 homolog 1, also known as RAD51A, is a human gene. The Rad51 gene, HsRAD51, is a homolog of RecA of Escherichia… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Rad51, Polyclonal Antibody
Full Product Name
Anti-Rad51 Antibody
Product Gene Name
anti-Rad51 antibody
Product Synonym Names
DNA repair protein RAD51 homolog 1; HsRAD51; hRAD51; RAD51 homolog A; RAD51; RAD51A; RECA; RAD51 recombinase
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
26,351 Da
3D Structure
ModBase 3D Structure for Q06609
Immunogen
A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-Rad51 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-Rad51 antibody
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Western Blot (WB) of anti-Rad51 antibody

Figure 1. Western blot analysis of Rad51 using anti-Rad51 antibody.
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate,
Lane 2: human A431 whole cell lysate,
Lane 3: human 293T whole cell lysate,
Lane 4: human K562 whole cell lysate,
Lane 5: human Jurkat whole cell lysate,
Lane 6: human A549 whole cell lysate,
Lane 7: human Caco-2 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Rad51 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Rad51 at approximately 39KD. The expected band size for Rad51 is at 36KD.
Rabbit Anti-RAD51 Polyclonal Antibody – Cat# MBS1751209

Immunohistochemistry (IHC) of anti-Rad51 antibody

Figure 3. IHC analysis of Rad51 using anti-Rad51 antibody.
Rad51 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-Rad51 antibody.
Rad51 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-Rad51 antibody.
Rad51 was detected in paraffin-embedded section of human testis tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-Rad51 antibody.
Rad51 was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-Rad51 Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-RAD51 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS1751209

Product References and Citations for anti-Rad51 antibody

1. Kato, M.; Yano, K.; Matsuo, F.; Saito, H.; Katagiri, T.; Kurumizaka, H.; Yoshimoto, M.; Kasumi, F.; Akiyama, F.; Sakamoto, G.; Nagawa, H.; Nakamura, Y.; Miki, Y.: Identification of Rad51 alteration in patients with bilateral breast cancer. J. Hum. Genet. 45: 133-137, 2000. 2. Daniel DC (2002). "Highlight: BRCA1 and BRCA2 proteins in breast cancer.". Microsc. Res. Tech. 59 (1): 68-83.

Other Notes

Small volumes of anti-Rad51 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Rad51 purchase

MBS1751209 is an antibody targeting Rad51. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for Rad51. It may not necessarily be applicable to this product.

NCBI GI #
256017143
NCBI GeneID
5888
NCBI Accession #
NP_001157741.1
UniProt Primary Accession #
Q06609
UniProt Secondary Accession #
Q6FHX9; Q6ZNA8; Q9BV60; B0FXP0; B2R8T6
UniProt Related Accession #
Q06609
GenBank Nucleotide #
NM_001164269.1
NCBI Official Full Name
DNA repair protein RAD51 homolog 1 isoform 2
NCBI Official Synonym Full Names
RAD51 recombinase
NCBI Official Symbol
RAD51
NCBI Official Synonym Symbols
RECA; BRCC5; FANCR; MRMV2; HRAD51; RAD51A; HsRad51; HsT16930
UniProt Protein Name
DNA repair protein RAD51 homolog 1
UniProt Synonym Protein Names
RAD51 homolog A
Protein Family
DNA repair protein
UniProt Gene Name
RAD51
UniProt Synonym Gene Names
RAD51A; RECA; HsRAD51; hRAD51
NCBI Protein Information
DNA repair protein RAD51 homolog 1

NCBI Summary for Rad51

The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]
Show more

UniProt Comments for Rad51

Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR) (PubMed:28575658). Binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange (PubMed:26681308). Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3. Also involved in interstrand cross-link repair (PubMed:26253028).
Show more

Research Articles on Rad51

1. Evidence has been provided that the majority of the Cas9-induced single nicks at the target DNA strand rely on RAD51 and BRCA2 for efficient and scar-less DNA repair.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-Rad51 antibody

 Reference Product  PubMed Publications
 RAD52 antibody  >404 publications with Rad51 and RAD52
 BRCA2 antibody  >402 publications with Rad51 and BRCA2
 BRCA1 antibody  >328 publications with Rad51 and BRCA1
 DMC1 antibody  >198 publications with Rad51 and DMC1
 ATM antibody  >149 publications with Rad51 and ATM
 RAD51C antibody  >102 publications with Rad51 and RAD51C
 BLM antibody  >73 publications with Rad51 and BLM
 FANCD2 antibody  >71 publications with Rad51 and FANCD2
 RAD54L antibody  >44 publications with Rad51 and RAD54L
 RPA1 antibody  >35 publications with Rad51 and RPA1

Pathways associated with anti-Rad51 antibody

 Products by Pathway  Pathway Diagram
 Assembly Of The RAD51-ssDNA Nucleoprotein Complex Pathway antibodies  Assembly Of The RAD51-ssDNA Nucleoprotein Complex Pathway Diagram
 BARD1 Signaling Events Pathway antibodies  BARD1 Signaling Events Pathway Diagram
 DNA Repair Pathway antibodies  DNA Repair Pathway Diagram
 DNA Damage Response Pathway antibodies  DNA Damage Response Pathway Diagram
 Double-Strand Break Repair Pathway antibodies  Double-Strand Break Repair Pathway Diagram
 Fanconi Anemia Pathway antibodies  Fanconi Anemia Pathway Diagram
 Fanconi Anemia Pathway antibodies  Fanconi Anemia Pathway Diagram
 Homologous DNA Pairing And Strand Exchange Pathway antibodies  Homologous DNA Pairing And Strand Exchange Pathway Diagram
 Homologous Recombination Repair Pathway antibodies  Homologous Recombination Repair Pathway Diagram
 Homologous Recombination Pathway antibodies  Homologous Recombination Pathway Diagram

Diseases associated with anti-Rad51 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >582 publications with Rad51 and Neoplasms
 Breast Neoplasms Antibodies  >240 publications with Rad51 and Breast Neoplasms
 Carcinoma Antibodies  >132 publications with Rad51 and Carcinoma
 Anemia Antibodies  >113 publications with Rad51 and Anemia
 Drug Toxicity Antibodies  >79 publications with Rad51 and Drug Toxicity
 Ovarian Neoplasms Antibodies  >70 publications with Rad51 and Ovarian Neoplasms
 Hematologic Diseases Antibodies  >67 publications with Rad51 and Hematologic Diseases
 Adenocarcinoma Antibodies  >46 publications with Rad51 and Adenocarcinoma
 Neoplasms, Experimental Antibodies  >45 publications with Rad51 and Neoplasms, Experimental
 Nervous System Diseases Antibodies  >40 publications with Rad51 and Nervous System Diseases

Organs/Tissues associated with anti-Rad51 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >102 publications with Rad51 and Blood
 Lung Antibodies  >59 publications with Rad51 and Lung
 Testis Antibodies  >56 publications with Rad51 and Testis
 Ovary Antibodies  >35 publications with Rad51 and Ovary
 Bone Antibodies  >32 publications with Rad51 and Bone
 Brain Antibodies  >30 publications with Rad51 and Brain
 Bone Marrow Antibodies  >28 publications with Rad51 and Bone Marrow
 Prostate Antibodies  >24 publications with Rad51 and Prostate
 Skin Antibodies  >23 publications with Rad51 and Skin
 Liver Antibodies  >17 publications with Rad51 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000