• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DDX54 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6146809

MBS6146809 is an antibody targeting DDX54. Also known as DDX54 (ATP-dependent RNA Helicase DDX54, ATP-dependent RNA Helicase DP97, DEAD Box RNA Helicase 97kD, DEAD Box Protein 54, MGC2835) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DDX54, Monoclonal Antibody
Full Product Name
DDX54 (ATP-dependent RNA Helicase DDX54, ATP-dependent RNA Helicase DP97, DEAD Box RNA Helicase 97kD, DEAD Box Protein 54, MGC2835) (FITC)
Product Gene Name
anti-DDX54 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H6
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human DDX54.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
97kDa
OMIM
611665
3D Structure
ModBase 3D Structure for Q8TDD1
Immunogen
Partial recombinant corresponding to aa778-882 from human DDX54 (NP_076977) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
Conjugate
FITC

Product Categories/Family for anti-DDX54 antibody

Antibodies; DEAD Box Proteins
Applications Tested/Suitable for anti-DDX54 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-DDX54 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-DDX54 antibody

Western Blot detection against Immunogen (37.55kD).
Mouse Anti-DDX54 Monoclonal Antibody – Cat# MBS6146809

Western Blot (WB) of anti-DDX54 antibody

Western Blot analysis of DDX54 expression in transfected 293T cell line by DDX54 monoclonal antibody. Lane 1: DDX54 transfected lysate (98.6kD). Lane 2: Non-transfected lysate.
Mouse Anti-DDX54 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146809

Immunohistochemistry (IHC) of anti-DDX54 antibody

Immunoperoxidase of monoclonal antibody to DDX54 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3ug/ml].
Mouse Anti-DDX54 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6146809

Immunofluorescence (IF) of anti-DDX54 antibody

Immunofluorescence of monoclonal antibody to DDX54 on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-DDX54 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6146809

Testing Data of anti-DDX54 antibody

Detection limit for recombinant GST tagged DDX54 is 0.03ng/ml as a capture antibody.
Mouse Anti-DDX54 Monoclonal Antibody, Testing Data – Cat# MBS6146809

Western Blot (WB) of anti-DDX54 antibody

DDX54 monoclonal antibody, Western Blot analysis of DDX54 expression in HeLa.
Mouse Anti-DDX54 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6146809

Other Notes

Small volumes of anti-DDX54 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for DDX54. It may not necessarily be applicable to this product.

NCBI GI #
51094101
NCBI GeneID
79039
NCBI Accession #
NP_076977
UniProt Primary Accession #
Q8TDD1
UniProt Related Accession #
Q8TDD1
GenBank Nucleotide #
NM_024072
NCBI Official Full Name
ATP-dependent RNA helicase DDX54 isoform 2
NCBI Official Synonym Full Names
DEAD-box helicase 54
NCBI Official Symbol
DDX54
NCBI Official Synonym Symbols
DP97
UniProt Protein Name
ATP-dependent RNA helicase DDX54
UniProt Synonym Protein Names
ATP-dependent RNA helicase DP97; DEAD box RNA helicase 97 kDa; DEAD box protein 54
Protein Family
ATP-dependent RNA helicase
UniProt Gene Name
DDX54
UniProt Entry Name
DDX54_HUMAN
NCBI Protein Information
ATP-dependent RNA helicase DDX54

NCBI Summary for DDX54

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for DDX54

DDX54: Has RNA-dependent ATPase activity. Represses the transcriptional activity of nuclear receptors. Belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; EC 3.6.4.13; Helicase; RNA processing; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: membrane; nucleolus; nucleus

Molecular Function: estrogen receptor binding; transcription corepressor activity; ATP binding; ATP-dependent RNA helicase activity; receptor binding

Biological Process: RNA processing; estrogen receptor signaling pathway; regulation of transcription, DNA-dependent; transcription, DNA-dependent; RNA metabolic process
Show more

Research Articles on DDX54

1. Ddx54 plays an important role in central nervous system myelination, presumably in myelin sheath formation after the differentiation of oligodendrocytes.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000