• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NUDT5 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148590

Hydrolyzes with similar activities ADP-ribose, ADP-mannose, and ADP-glucose. Can also hydrolyze other nucleotide sugars with low activity. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NUDT5, Monoclonal Antibody
Full Product Name
NUDT5 (ADP-sugar Pyrophosphatase, 8-oxo-dGDP Phosphatase, Nucleoside Diphosphate-linked Moiety X Motif 5, Nudix Motif 5, YSA1H, HSPC115) (FITC)
Product Gene Name
anti-NUDT5 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NUDT5.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
609230
3D Structure
ModBase 3D Structure for Q9UKK9
Immunogen
Partial recombinant corresponding to aa120-220 from NUDT5 (NP_054861 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF*
Conjugate
FITC

Product Categories/Family for anti-NUDT5 antibody

Antibodies; Enzymes; Phosphatase
Applications Tested/Suitable for anti-NUDT5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-NUDT5 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-NUDT5 antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-NUDT5 Monoclonal Antibody – Cat# MBS6148590

Western Blot (WB) of anti-NUDT5 antibody

Western Blot analysis of NUDT5 expression in transfected 293T cell line by NUDT5 monoclonal antibody Lane 1: NUDT5 transfected lysate (24.3kD). Lane 2: Non-transfected lysate.
Mouse Anti-NUDT5 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6148590

Testing Data of anti-NUDT5 antibody

Detection limit for recombinant GST tagged NUDT5 is ~1ng/ml as a capture antibody.
Mouse Anti-NUDT5 Monoclonal Antibody, Testing Data – Cat# MBS6148590

Western Blot (WB) of anti-NUDT5 antibody

Western blot analysis of NUDT5 over-expressed 293 cell line, cotransfected with NUDT5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with NUDT5 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-NUDT5 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6148590

Other Notes

Small volumes of anti-NUDT5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NUDT5 purchase

MBS6148590 is an antibody targeting NUDT5. Also known as NUDT5 (ADP-sugar Pyrophosphatase, 8-oxo-dGDP Phosphatase, Nucleoside Diphosphate-linked Moiety X Motif 5, Nudix Motif 5, YSA1H, HSPC115) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for NUDT5. It may not necessarily be applicable to this product.

NCBI GI #
1519315377
NCBI GeneID
11164
NCBI Accession #
NM_014142.4
UniProt Primary Accession #
Q9UKK9
UniProt Related Accession #
Q9UKK9
GenBank Nucleotide #
NM_014142
NCBI Official Full Name
Homo sapiens nudix hydrolase 5 (NUDT5), transcript variant 1, mRNA
NCBI Official Synonym Full Names
nudix hydrolase 5
NCBI Official Symbol
NUDT5
NCBI Official Synonym Symbols
YSA1; YSA1H; YSAH1; hNUDT5
UniProt Protein Name
ADP-sugar pyrophosphatase
UniProt Synonym Protein Names
8-oxo-dGDP phosphatase (EC:3.6.1.58); Nucleoside diphosphate-linked moiety X motif 5; Nudix motif 5; YSA1H
Protein Family
ADP-sugar pyrophosphatase
UniProt Gene Name
NUDT5
UniProt Synonym Gene Names
Nudix motif 5
UniProt Entry Name
NUDT5_HUMAN
NCBI Protein Information
ADP-sugar pyrophosphatase

NCBI Summary for NUDT5

This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors. [provided by RefSeq, Aug 2013]
Show more

UniProt Comments for NUDT5

NUDT5: Hydrolyzes with similar activities ADP-ribose ADP- mannose, ADP-glucose, 8-oxo-GDP and 8-oxo-dGDP. Can also hydrolyze other nucleotide sugars with low activity. Belongs to the Nudix hydrolase family.

Protein type: EC 3.6.1.13; Nucleotide Metabolism - purine; Phosphatase; EC 3.6.1.58

Chromosomal Location of Human Ortholog: 10p14

Cellular Component: intracellular; cytosol; nucleus

Molecular Function: snoRNA binding; m7G(5')pppN diphosphatase activity; ADP-ribose diphosphatase activity; nucleoside-diphosphatase activity; magnesium ion binding; ADP-sugar diphosphatase activity

Biological Process: nucleobase, nucleoside and nucleotide metabolic process; nucleotide metabolic process; D-ribose catabolic process; ribonucleoside diphosphate catabolic process
Show more

Research Articles on NUDT5

1. Data suggest that targeting nudix hydrolase 5 (NUDT5) may represent a promising new therapeutic approach for breast cancer treatment.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000