• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

WWP1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6150487

MBS6150487 is an antibody targeting WWP1. Also known as WWP1 (WW Domain-containing Protein 1, Atrophin-1-interacting Protein 5, AIP5, NEDD4-like E3 Ubiquitin-protein Ligase WWP1, TGIF-interacting Ubiquitin Ligase 1, Tiul1, hSDRP1) (FITC). Reactive in Human.… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
WWP1, Monoclonal Antibody
Full Product Name
WWP1 (WW Domain-containing Protein 1, Atrophin-1-interacting Protein 5, AIP5, NEDD4-like E3 Ubiquitin-protein Ligase WWP1, TGIF-interacting Ubiquitin Ligase 1, Tiul1, hSDRP1) (FITC)
Product Gene Name
anti-WWP1 antibody
Product Synonym Names
WW Domain Containing E3 Ubiquitin Protein Ligase 1; EC=6.3.2.-
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human WWP1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
105kDa
OMIM
AL136739 mRNA
3D Structure
ModBase 3D Structure for Q9H0M0
Immunogen
Partial recombinant corresponding to aa152-261 from human WWP1 (NP_008944) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
Conjugate
FITC

Product Categories/Family for anti-WWP1 antibody

Antibodies; Ubiquitin Ligases
Applications Tested/Suitable for anti-WWP1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-WWP1 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-WWP1 antibody

Western Blot detection against Immunogen (38.1kD).
Mouse Anti-WWP1 Monoclonal Antibody – Cat# MBS6150487

Western Blot (WB) of anti-WWP1 antibody

Western Blot analysis of WWP1 expression in transfected 293T cell line by WWP1 monoclonal antibody Lane 1: WWP1 transfected lysate (105.2kD). Lane 2: Non-transfected lysate.
Mouse Anti-WWP1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6150487

Immunohistochemistry (IHC) of anti-WWP1 antibody

Immunoperoxidase of monoclonal antibody to WWP1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].
Mouse Anti-WWP1 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6150487

Immunofluorescence (IF) of anti-WWP1 antibody

Immunofluorescence of monoclonal antibody to WWP1 on A-431 cell. [antibody concentration 10ug/ml].
Mouse Anti-WWP1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6150487

Immunoprecipitation (IP) of anti-WWP1 antibody

Immunoprecipitation of WWP1 transfected lysate using WWP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with WWP1 rabbit polyclonal antibody.
Mouse Anti-WWP1 Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6150487

Testing Data of anti-WWP1 antibody

Detection limit for recombinant GST tagged WWP1 is 0.03ng/ml as a capture antibody.
Mouse Anti-WWP1 Monoclonal Antibody, Testing Data – Cat# MBS6150487

Other Notes

Small volumes of anti-WWP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for WWP1. It may not necessarily be applicable to this product.

NCBI GI #
13654239
NCBI GeneID
11059
NCBI Accession #
NP_008944
UniProt Primary Accession #
Q9H0M0
UniProt Related Accession #
Q9H0M0
GenBank Nucleotide #
NM_007013
NCBI Official Full Name
NEDD4-like E3 ubiquitin-protein ligase WWP1
NCBI Official Synonym Full Names
WW domain containing E3 ubiquitin protein ligase 1
NCBI Official Symbol
WWP1
NCBI Official Synonym Symbols
AIP5; Tiul1; hSDRP1
UniProt Protein Name
NEDD4-like E3 ubiquitin-protein ligase WWP1
UniProt Synonym Protein Names
Atrophin-1-interacting protein 5; AIP5; HECT-type E3 ubiquitin transferase WWP1; TGIF-interacting ubiquitin ligase 1; Tiul1; WW domain-containing protein 1
Protein Family
NEDD4-like E3 ubiquitin-protein ligase
UniProt Gene Name
WWP1
UniProt Synonym Gene Names
AIP5; Tiul1
NCBI Protein Information
NEDD4-like E3 ubiquitin-protein ligase WWP1

NCBI Summary for WWP1

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for WWP1

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Ubiquitinates ERBB4 isoforms JM-A CYT-1 and JM-B CYT-1, KLF2, KLF5 and TP63 and promotes their proteasomal degradation. Ubiquitinates RNF11 without targeting it for degradation. Ubiquitinates and promotes degradation of TGFBR1; the ubiquitination is enhanced by SMAD7. Ubiquitinates SMAD6 and SMAD7. Ubiquitinates and promotes degradation of SMAD2 in response to TGF-beta signaling, which requires interaction with TGIF.
Show more

Research Articles on WWP1

1. Provide molecular insights into the anti-cancer potential of WWP1 inhibition.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-WWP1 antibody

 Reference Product  PubMed Publications
 KLF2 antibody  >3 publications with WWP1 and KLF2
 RNF11 antibody  >2 publications with WWP1 and RNF11
 WBP1 antibody  >1 publications with WWP1 and WBP1
 NFE2 antibody  >1 publications with WWP1 and NFE2
 DAG1 antibody  >1 publications with WWP1 and DAG1

Pathways associated with anti-WWP1 antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Antigen Processing: Ubiquitination & Proteasome Degradation Pathway antibodies  Antigen Processing: Ubiquitination & Proteasome Degradation Pathway Diagram
 Class I MHC Mediated Antigen Processing & Presentation Pathway antibodies  Class I MHC Mediated Antigen Processing & Presentation Pathway Diagram
 Downregulation Of ERBB4 Signaling Pathway antibodies  Downregulation Of ERBB4 Signaling Pathway Diagram
 Endocytosis Pathway antibodies  Endocytosis Pathway Diagram
 Endocytosis Pathway antibodies  Endocytosis Pathway Diagram
 ErbB4 Signaling Events Pathway antibodies  ErbB4 Signaling Events Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram
 Signaling By ERBB4 Pathway antibodies  Signaling By ERBB4 Pathway Diagram

Diseases associated with anti-WWP1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >17 publications with WWP1 and Neoplasms
 Breast Neoplasms Antibodies  >12 publications with WWP1 and Breast Neoplasms
 Skin Diseases Antibodies  >11 publications with WWP1 and Skin Diseases
 Disease Models, Animal Antibodies  >4 publications with WWP1 and Disease Models, Animal
 Nervous System Diseases Antibodies  >3 publications with WWP1 and Nervous System Diseases
 Cell Transformation, Neoplastic Antibodies  >2 publications with WWP1 and Cell Transformation, Neoplastic
 Necrosis Antibodies  >2 publications with WWP1 and Necrosis
 Drug Hypersensitivity Antibodies  >1 publications with WWP1 and Drug Hypersensitivity
 Brain Diseases Antibodies  >1 publications with WWP1 and Brain Diseases
 Drug Toxicity Antibodies  >1 publications with WWP1 and Drug Toxicity

Organs/Tissues associated with anti-WWP1 antibody

 Organ/Tissue Name  Pubmed Publications
 Prostate Antibodies  >7 publications with WWP1 and Prostate
 Bone Antibodies  >7 publications with WWP1 and Bone
 Muscle Antibodies  >4 publications with WWP1 and Muscle
 Blood Antibodies  >3 publications with WWP1 and Blood
 Lung Antibodies  >3 publications with WWP1 and Lung
 Bone Marrow Antibodies  >2 publications with WWP1 and Bone Marrow
 Connective Tissue Antibodies  >2 publications with WWP1 and Connective Tissue
 Brain Antibodies  >2 publications with WWP1 and Brain
 Heart Antibodies  >1 publications with WWP1 and Heart
 Liver Antibodies  >1 publications with WWP1 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000