• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CHL1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6183520

MBS6183520 is an antibody targeting CHL1. Also known as CHL1 (Cell Adhesion Molecule with Homology to L1CAM (close Homolog of L1), CALL, FLJ44930, L1CAM2, MGC132578) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CHL1, Monoclonal Antibody
Full Product Name
CHL1 (Cell Adhesion Molecule with Homology to L1CAM (close Homolog of L1), CALL, FLJ44930, L1CAM2, MGC132578) (HRP)
Product Gene Name
anti-CHL1 antibody
Product Synonym Names
Cell Adhesion Molecule with Homology to L1CAM (close Homolog of L1); CALL; FLJ44930; L1CAM2; MGC132578
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H5
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified
Specificity
Recognizes CHL1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
136,698 Da
OMIM
AF002246 mRNA
3D Structure
ModBase 3D Structure for O00533
Immunogen
CHL1 (NP_006605, 26aa-135aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Conjugate
HRP

Product Categories/Family for anti-CHL1 antibody

Antibodies; Nuclear Proteins
Applications Tested/Suitable for anti-CHL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-CHL1 antibody
Applications are based on unconjugated antibody.

Testing Data of anti-CHL1 antibody

Detection limit for recombinant GST tagged CHL1 is 0.3 ng/ml as a capture antibody.
Mouse Anti-CHL1 Monoclonal Antibody – Cat# MBS6183520

Other Notes

Small volumes of anti-CHL1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CHL1. It may not necessarily be applicable to this product.

NCBI GI #
27894376
NCBI GeneID
10752
NCBI Accession #
NP_006605
UniProt Primary Accession #
O00533
UniProt Secondary Accession #
Q2M3G2; Q59FY0; B7ZL03
UniProt Related Accession #
O00533
GenBank Nucleotide #
NM_006614
NCBI Official Full Name
neural cell adhesion molecule L1-like protein isoform 1
NCBI Official Synonym Full Names
cell adhesion molecule L1-like
NCBI Official Symbol
CHL1
NCBI Official Synonym Symbols
CALL; L1CAM2
UniProt Protein Name
Neural cell adhesion molecule L1-like protein
UniProt Synonym Protein Names
Close homolog of L1
Protein Family
ATP-dependent DNA helicase
UniProt Gene Name
CHL1
UniProt Synonym Gene Names
CALL
NCBI Protein Information
neural cell adhesion molecule L1-like protein; L1 cell adhesion molecule 2; cell adhesion molecule with homology to L1CAM (close homolog of L1); cell adhesion molecule with homology to L1CAM (close homologue of L1)

UniProt Comments for CHL1

CHL1: Extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. Both soluble and membranous forms promote neurite outgrowth of cerebellar and hippocampal neurons and suppress neuronal cell death. Plays a role in neuronal positioning of pyramidal neurons and in regulation of both the number of interneurons and the efficacy of GABAergic synapses. May play a role in regulating cell migration in nerve regeneration and cortical development. Potentiates integrin-dependent cell migration towards extracellular matrix proteins. Recruits ANK3 to the plasma membrane. Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Cell development/differentiation; Extracellular matrix; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p26.3

Biological Process: signal transduction
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CHL1 antibody

 Products by Pathway  Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 CHL1 Interactions Pathway antibodies  CHL1 Interactions Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 L1CAM Interactions Pathway antibodies  L1CAM Interactions Pathway Diagram

Diseases associated with anti-CHL1 antibody

 Disease Name  Pubmed Publications
 Schizophrenia Antibodies  >9 publications with CHL1 and Schizophrenia
 Neurobehavioral Manifestations Antibodies  >8 publications with CHL1 and Neurobehavioral Manifestations
 Intellectual Disability Antibodies  >8 publications with CHL1 and Intellectual Disability
 Cardiovascular Diseases Antibodies  >4 publications with CHL1 and Cardiovascular Diseases
 Learning Disorders Antibodies  >4 publications with CHL1 and Learning Disorders
 Heart Diseases Antibodies  >4 publications with CHL1 and Heart Diseases
 Heart Defects, Congenital Antibodies  >2 publications with CHL1 and Heart Defects, Congenital
 Liver Neoplasms Antibodies  >2 publications with CHL1 and Liver Neoplasms
 Lung Neoplasms Antibodies  >1 publications with CHL1 and Lung Neoplasms
 Drug-Related Side Effects and Adverse Reactions Antibodies  >1 publications with CHL1 and Drug-Related Side Effects and Adverse Reactions

Organs/Tissues associated with anti-CHL1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >51 publications with CHL1 and Brain
 Nerve Antibodies  >27 publications with CHL1 and Nerve
 Eye Antibodies  >3 publications with CHL1 and Eye
 Placenta Antibodies  >3 publications with CHL1 and Placenta
 Skin Antibodies  >3 publications with CHL1 and Skin
 Lung Antibodies  >2 publications with CHL1 and Lung
 Intestine Antibodies  >2 publications with CHL1 and Intestine
 Liver Antibodies  >2 publications with CHL1 and Liver
 Mouth Antibodies  >2 publications with CHL1 and Mouth
 Kidney Antibodies  >2 publications with CHL1 and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000