Mouse Anti-DFF45 Monoclonal Antibody – Cat# MBS6200454

DFF45 Antibody – Mouse Monoclonal

Name: DFF45 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6200454
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6200454

MBS6200454 is an antibody targeting DFF45. Also known as DFF45 (DNA Fragmentation Factor Subunit alpha, DNA Fragmentation Factor 45kD Subunit, DFF-45, Inhibitor of CAD, ICAD, DFFA, DFF1, H13) (MaxLight 490). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

DFF45, Monoclonal Antibody

Full Product Name

DFF45 (DNA Fragmentation Factor Subunit alpha, DNA Fragmentation Factor 45kD Subunit, DFF-45, Inhibitor of CAD, ICAD, DFFA, DFF1, H13) (MaxLight 490)

Product Gene Name

anti-DFF45 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3A11

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human DFFA.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

36,522 Da

Chromosome Location

Chromosome: 1; NC_000001.10 (10520588..10532613, complement). Location: 1p36.3-p36.2

OMIM

601882

3D Structure

ModBase 3D Structure for O00273

Immunogen

Partial recombinant corresponding to aa231-331 from human DFFA (NP_004392.1) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Conjugate

MaxLight490

Product Categories/Family for anti-DFF45 antibody

Antibodies; Apoptosis

Applications Tested/Suitable for anti-DFF45 antibody

FLISA, Western Blot (WB)

Application Notes for anti-DFF45 antibody

Sandwich FLISA: The detection limit is ~0.1ng/ml as a capture antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-DFF45 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for DFF45. It may not necessarily be applicable to this product.

NCBI GI #

4758148

NCBI GeneID

1676

NCBI Accession #

NP_004392.1

UniProt Primary Accession #

O00273

UniProt Secondary Accession #

Q5T6G5; Q5T6G6; Q96I97; Q9Y6C6

UniProt Related Accession #

O00273

GenBank Nucleotide #

NM_004401

NCBI Official Full Name

DNA fragmentation factor subunit alpha isoform 1

NCBI Official Synonym Full Names

DNA fragmentation factor, 45kDa, alpha polypeptide

NCBI Official Symbol

DFFA

NCBI Official Synonym Symbols

DFF1; ICAD; DFF-45

UniProt Protein Name

DNA fragmentation factor subunit alpha

UniProt Synonym Protein Names

DNA fragmentation factor 45 kDa subunit; DFF-45; Inhibitor of CAD

UniProt Gene Name

DFFA

UniProt Synonym Gene Names

DFF1; DFF45; DFF-45; ICAD

UniProt Entry Name

DFFA_HUMAN

NCBI Protein Information

DNA fragmentation factor subunit alpha; DFF45; inhibitor of CAD; DNA fragmentation factor 45 kDa subunit

NCBI Summary for DFF45

Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

UniProt Comments for DFF45

DFFA: Inhibitor of the caspase-activated DNase (DFF40). Heterodimer of DFFA and DFFB. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase

Chromosomal Location of Human Ortholog: 1p36.3-p36.2

Cellular Component: nucleoplasm; nuclear chromatin; cytoplasm; lipid particle; nucleus; cytosol

Molecular Function: protein binding

Biological Process: positive regulation of apoptosis; apoptosis; DNA fragmentation during apoptosis; cell structure disassembly during apoptosis

Research Articles on DFF45

1. mRNA splicing is actively driven toward the pro-apoptotic isoforms of Bim, Bcl-x, and ICAD in Pnn-depleted MCF-7 cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DFF45 antibody

Reference Product	PubMed Publications
CIDEB antibody	>6 publications with DFF45 and CIDEB
DFFB antibody	>5 publications with DFF45 and DFFB
CASP3 antibody	>4 publications with DFF45 and CASP3

Pathways associated with anti-DFF45 antibody

Products by Pathway	Pathway Diagram
Activation Of DNA Fragmentation Factor Pathway antibodies	Activation Of DNA Fragmentation Factor Pathway Diagram
Apoptosis Pathway antibodies	Apoptosis Pathway Diagram
Apoptosis Pathway antibodies	Apoptosis Pathway Diagram
Apoptosis Pathway antibodies	Apoptosis Pathway Diagram
Apoptosis Pathway antibodies	Apoptosis Pathway Diagram
Apoptosis Modulation And Signaling Pathway antibodies	Apoptosis Modulation And Signaling Pathway Diagram
Apoptosis Induced DNA Fragmentation Pathway antibodies	Apoptosis Induced DNA Fragmentation Pathway Diagram
Apoptotic Execution Phase Pathway antibodies	Apoptotic Execution Phase Pathway Diagram
Caspase Cascade In Apoptosis Pathway antibodies	Caspase Cascade In Apoptosis Pathway Diagram
FAS Pathway And Stress Induction Of HSP Regulation antibodies	FAS Pathway And Stress Induction Of HSP Regulation Diagram

Diseases associated with anti-DFF45 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>12 publications with DFF45 and Neoplasms
Necrosis Antibodies	>6 publications with DFF45 and Necrosis
Fatty Liver Antibodies	>4 publications with DFF45 and Fatty Liver
Liver Diseases Antibodies	>4 publications with DFF45 and Liver Diseases
Uterine Cervical Neoplasms Antibodies	>2 publications with DFF45 and Uterine Cervical Neoplasms
Disease Models, Animal Antibodies	>1 publications with DFF45 and Disease Models, Animal
Drug Toxicity Antibodies	>1 publications with DFF45 and Drug Toxicity
Neoplasm Invasiveness Antibodies	>1 publications with DFF45 and Neoplasm Invasiveness
Neoplasm Metastasis Antibodies	>1 publications with DFF45 and Neoplasm Metastasis
Adenocarcinoma Antibodies	>1 publications with DFF45 and Adenocarcinoma

Organs/Tissues associated with anti-DFF45 antibody

Organ/Tissue Name	Pubmed Publications
Liver Antibodies	>9 publications with DFF45 and Liver
Connective Tissue Antibodies	>7 publications with DFF45 and Connective Tissue
Muscle Antibodies	>3 publications with DFF45 and Muscle
Eye Antibodies	>2 publications with DFF45 and Eye
Heart Antibodies	>2 publications with DFF45 and Heart
Blood Antibodies	>2 publications with DFF45 and Blood
Vascular Antibodies	>1 publications with DFF45 and Vascular
Kidney Antibodies	>1 publications with DFF45 and Kidney
Skin Antibodies	>1 publications with DFF45 and Skin
Lung Antibodies	>1 publications with DFF45 and Lung