Mouse Anti-MYBL2 Monoclonal Antibody – Cat# MBS6201976

MYBL2 Antibody – Mouse Monoclonal

Name: MYBL2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6201976
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6201976

MBS6201976 is an antibody targeting MYBL2. Also known as MYBL2 (Myb-related Protein B, B-Myb, Myb-like Protein 2, BMYB, MGC15600) (MaxLight 490). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MYBL2, Monoclonal Antibody

Full Product Name

MYBL2 (Myb-related Protein B, B-Myb, Myb-like Protein 2, BMYB, MGC15600) (MaxLight 490)

Product Gene Name

anti-MYBL2 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1C7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human MYBL2.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

Partial recombinant corresponding to aa601-700 from human MYBL2 (AAH53555) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS

Conjugate

MaxLight490

Product Categories/Family for anti-MYBL2 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-MYBL2 antibody

FLISA, Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-MYBL2 antibody

IF: 10ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-MYBL2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for MYBL2. It may not necessarily be applicable to this product.

NCBI GI #

31565775

NCBI GeneID

4605

NCBI Accession #

BC053555

NCBI Related Accession #

AAH53555

UniProt Related Accession #

P10244

NCBI Official Full Name

Homo sapiens v-myb myeloblastosis viral oncogene homolog (avian)-like 2, mRNA

NCBI Official Synonym Full Names

MYB proto-oncogene like 2

NCBI Official Symbol

MYBL2

NCBI Official Synonym Symbols

BMYB; B-MYB

Protein Family

Myb-related protein

NCBI Protein Information

myb-related protein B

NCBI Summary for MYBL2

The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013]

Research Articles on MYBL2

1. we discovered a circRNA, circMYBL2, derived from the cell-cycle checkpoint gene MYBL2. circMYBL2 is more highly expressed in acute myeloid leukemia patients with FLT3-ITD mutations than in those without the FLT3-ITD mutation

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.