Rabbit Anti-IAPP Polyclonal Antibody – Cat# MBS6462847

Amylin (IAPP) Antibody – Rabbit Polyclonal

Name: IAPP Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6462847
Price: 1165 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6462847

MBS6462847 is an antibody targeting IAPP. Also known as Amylin (DAP, Diabetes-Associated Peptide, IAP, Islet Amyloid Polypeptide, Insulinoma Amyloid Peptide, IAPP) (FITC). Reactive in Human. Host: Rabbit. More details

$1165 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Amylin (IAPP), Polyclonal Antibody

Full Product Name

Amylin (DAP, Diabetes-Associated Peptide, IAP, Islet Amyloid Polypeptide, Insulinoma Amyloid Peptide, IAPP) (FITC)

Product Gene Name

anti-IAPP antibody

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

Purity/Purification

Purified

Specificity

Recognizes human Amylin in transfected 293T cells.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

9,806 Da

Chromosome Location

Chromosome: 12; NC_000012.11 (21525802..21532914). Location: 12p12.1

OMIM

147940

3D Structure

ModBase 3D Structure for P10997

Immunogen

Full length protein corresponding to aa1-89 from human Amylin.

Immunogen Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Conjugate

FITC

Note

Preservative Free

Product Categories/Family for anti-IAPP antibody

Antibodies; Neuroscience

Applications Tested/Suitable for anti-IAPP antibody

Western Blot (WB)

Application Notes for anti-IAPP antibody

WB: Transfected 293T cells
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-IAPP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for IAPP. It may not necessarily be applicable to this product.

NCBI GI #

4557655

NCBI GeneID

3375

NCBI Accession #

NP_000406.1

UniProt Primary Accession #

P10997

UniProt Secondary Accession #

Q0ZD87; Q14598

UniProt Related Accession #

P10997

GenBank Nucleotide #

NM_000415.2

NCBI Official Full Name

islet amyloid polypeptide

NCBI Official Synonym Full Names

islet amyloid polypeptide

NCBI Official Symbol

IAPP

NCBI Official Synonym Symbols

DAP; IAP

UniProt Protein Name

Islet amyloid polypeptide

UniProt Synonym Protein Names

Amylin; Diabetes-associated peptide; DAP; Insulinoma amyloid peptide

Protein Family

Islet amyloid polypeptide

UniProt Gene Name

IAPP

UniProt Synonym Gene Names

DAP

UniProt Entry Name

IAPP_HUMAN

NCBI Protein Information

islet amyloid polypeptide; amylin; insulinoma amyloid peptide; diabetes-associated peptide; Islet amyloid polypeptide (diabetes-associated peptide; amylin)

NCBI Summary for IAPP

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the association of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. [provided by RefSeq, Apr 2011]

UniProt Comments for IAPP

IAPP: Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. Belongs to the calcitonin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 12p12.1

Cellular Component: extracellular space; cell soma; extracellular region

Molecular Function: identical protein binding; hormone activity; receptor binding

Biological Process: negative regulation of cell differentiation; cell-cell signaling; apoptosis; eating behavior; signal transduction; sensory perception of pain; negative regulation of bone resorption; endocrine pancreas development

Research Articles on IAPP

1. Studies indicate that IAPP is one of the most amyloidogenic sequences known.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-IAPP antibody

Reference Product	PubMed Publications
RAMP1 antibody	>27 publications with IAPP and RAMP1
PDX1 antibody	>23 publications with IAPP and PDX1
RAMP2 antibody	>16 publications with IAPP and RAMP2
PCSK1 antibody	>2 publications with IAPP and PCSK1
PCSK2 antibody	>1 publications with IAPP and PCSK2

Pathways associated with anti-IAPP antibody

Products by Pathway	Pathway Diagram
Amyloids Pathway antibodies	Amyloids Pathway Diagram
Calcitonin-like Ligand Receptors Pathway antibodies	Calcitonin-like Ligand Receptors Pathway Diagram
Class B/2 (Secretin Family Receptors) Pathway antibodies	Class B/2 (Secretin Family Receptors) Pathway Diagram
Developmental Biology Pathway antibodies	Developmental Biology Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
G Alpha (s) Signalling Events Pathway antibodies	G Alpha (s) Signalling Events Pathway Diagram
GPCR Downstream Signaling Pathway antibodies	GPCR Downstream Signaling Pathway Diagram
GPCR Ligand Binding Pathway antibodies	GPCR Ligand Binding Pathway Diagram
Integrated Pancreatic Cancer Pathway antibodies	Integrated Pancreatic Cancer Pathway Diagram
Maturity Onset Diabetes Of The Young Pathway antibodies	Maturity Onset Diabetes Of The Young Pathway Diagram

Diseases associated with anti-IAPP antibody

Disease Name	Pubmed Publications
Diabetes Mellitus Antibodies	>839 publications with IAPP and Diabetes Mellitus
Diabetes Mellitus, Type 2 Antibodies	>547 publications with IAPP and Diabetes Mellitus, Type 2
Hyperglycemia Antibodies	>162 publications with IAPP and Hyperglycemia
Hyperinsulinism Antibodies	>108 publications with IAPP and Hyperinsulinism
Diabetes Mellitus, Experimental Antibodies	>80 publications with IAPP and Diabetes Mellitus, Experimental
Drug Toxicity Antibodies	>72 publications with IAPP and Drug Toxicity
Ulcer Antibodies	>51 publications with IAPP and Ulcer
Hypertension Antibodies	>34 publications with IAPP and Hypertension
Inflammation Antibodies	>25 publications with IAPP and Inflammation
Kidney Diseases Antibodies	>19 publications with IAPP and Kidney Diseases

Organs/Tissues associated with anti-IAPP antibody

Organ/Tissue Name	Pubmed Publications
Pancreas Antibodies	>745 publications with IAPP and Pancreas
Connective Tissue Antibodies	>38 publications with IAPP and Connective Tissue
Mixed Antibodies	>33 publications with IAPP and Mixed
Testis Antibodies	>1 publications with IAPP and Testis