• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CBR1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6372393

Carbonyl reductase 1 (CBR1)is one of several monomeric,NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. More details

$965 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CBR1, Polyclonal Antibody
Full Product Name
CBR1 (Carbonyl Reductase [NADPH] 1, NADPH-dependent Carbonyl Reductase 1, Prostaglandin-E(2) 9-reductase, Prostaglandin 9-ketoreductase, 15-hydroxyprostaglandin Dehydrogenase [NADP+], CBR, CRN) (MaxLight 405)
Product Gene Name
anti-CBR1 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CBR1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
30,375 Da
Chromosome Location
Chromosome: 21; NC_000021.8 (37442285..37445462). Location: 21q22.13
OMIM
114830
3D Structure
ModBase 3D Structure for P16152
Immunogen
Full length human CBR1, aa1-277 (NP_001748.1).
Immunogen Sequence
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Conjugate
MaxLight405
Note
Preservative Free

Product Categories/Family for anti-CBR1 antibody

Antibodies; Enzymes; Dehydrogenase
Applications Tested/Suitable for anti-CBR1 antibody
Western Blot (WB)
Application Notes for anti-CBR1 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CBR1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CBR1 purchase

MBS6372393 is an antibody targeting CBR1. Also known as CBR1 (Carbonyl Reductase [NADPH] 1, NADPH-dependent Carbonyl Reductase 1, Prostaglandin-E(2) 9-reductase, Prostaglandin 9-ketoreductase, 15-hydroxyprostaglandin Dehydrogenase [NADP+], CBR, CRN) (MaxLight 405). Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for CBR1. It may not necessarily be applicable to this product.

NCBI GI #
4502599
NCBI GeneID
873
NCBI Accession #
NP_001748.1
UniProt Primary Accession #
P16152
UniProt Secondary Accession #
Q3LHW8; B2RBZ7
UniProt Related Accession #
P16152
GenBank Nucleotide #
NM_001757.2
NCBI Official Full Name
carbonyl reductase
NCBI Official Synonym Full Names
carbonyl reductase 1
NCBI Official Symbol
CBR1
NCBI Official Synonym Symbols
CBR; hCBR1; SDR21C1
UniProt Protein Name
Carbonyl reductase [NADPH] 1
UniProt Synonym Protein Names
15-hydroxyprostaglandin dehydrogenase [NADP(+)] (EC:1.1.1.197); NADPH-dependent carbonyl reductase 1; Prostaglandin 9-ketoreductase; Prostaglandin-E(2) 9-reductase (EC:1.1.1.189)
Protein Family
Carbonyl reductase
UniProt Gene Name
CBR1
UniProt Synonym Gene Names
CBR; CRN
UniProt Entry Name
CBR1_HUMAN
NCBI Protein Information
carbonyl reductase [NADPH] 1; carbonyl reductase [NADPH] 1; carbonyl reductase (NADPH) 1; prostaglandin 9-ketoreductase; prostaglandin-E(2) 9-reductase; NADPH-dependent carbonyl reductase 1; 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase

NCBI Summary for CBR1

Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q. [provided by RefSeq, Jul 2008]

UniProt Comments for CBR1

CBR1: NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione. Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: Lipid Metabolism - arachidonic acid; EC 1.1.1.189; EC 1.1.1.197; EC 1.1.1.184; Oxidoreductase

Chromosomal Location of Human Ortholog: 21q22.13

Cellular Component: cytosol; vesicle

Molecular Function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor; prostaglandin-E2 9-reductase activity; 15-hydroxyprostaglandin dehydrogenase (NADP+) activity; carbonyl reductase (NADPH) activity

Biological Process: epithelial cell differentiation; vitamin K metabolic process; cyclooxygenase pathway; arachidonic acid metabolic process; drug metabolic process
Show more

Research Articles on CBR1

1. regulation of human CBR1 expression by hsa-miR-574-5p and hsa-miR-921 depends upon rs9024 genotype status

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CBR1 antibody

 Products by Pathway  Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Chemical Carcinogenesis Pathway antibodies  Chemical Carcinogenesis Pathway Diagram
 Chemical Carcinogenesis Pathway antibodies  Chemical Carcinogenesis Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Lipids And Lipoproteins Pathway antibodies  Metabolism Of Lipids And Lipoproteins Pathway Diagram
 Metabolism Of Xenobiotics By Cytochrome P450 Pathway antibodies  Metabolism Of Xenobiotics By Cytochrome P450 Pathway Diagram
 Metabolism Of Xenobiotics By Cytochrome P450 Pathway antibodies  Metabolism Of Xenobiotics By Cytochrome P450 Pathway Diagram
 Synthesis Of Prostaglandins (PG) And Thromboxanes (TX) Pathway antibodies  Synthesis Of Prostaglandins (PG) And Thromboxanes (TX) Pathway Diagram

Diseases associated with anti-CBR1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >24 publications with CBR1 and Neoplasms
 Drug Toxicity Antibodies  >11 publications with CBR1 and Drug Toxicity
 Liver Neoplasms Antibodies  >5 publications with CBR1 and Liver Neoplasms
 Adenocarcinoma Antibodies  >5 publications with CBR1 and Adenocarcinoma
 Liver Diseases Antibodies  >5 publications with CBR1 and Liver Diseases
 Fibrosis Antibodies  >3 publications with CBR1 and Fibrosis
 Necrosis Antibodies  >3 publications with CBR1 and Necrosis
 Congenital Abnormalities Antibodies  >3 publications with CBR1 and Congenital Abnormalities
 Heart Diseases Antibodies  >3 publications with CBR1 and Heart Diseases
 Carcinoma, Hepatocellular Antibodies  >3 publications with CBR1 and Carcinoma, Hepatocellular

Organs/Tissues associated with anti-CBR1 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >15 publications with CBR1 and Liver
 Blood Antibodies  >8 publications with CBR1 and Blood
 Brain Antibodies  >8 publications with CBR1 and Brain
 Uterus Antibodies  >7 publications with CBR1 and Uterus
 Ovary Antibodies  >5 publications with CBR1 and Ovary
 Muscle Antibodies  >4 publications with CBR1 and Muscle
 Heart Antibodies  >4 publications with CBR1 and Heart
 Lung Antibodies  >4 publications with CBR1 and Lung
 Nerve Antibodies  >4 publications with CBR1 and Nerve
 Pancreas Antibodies  >3 publications with CBR1 and Pancreas
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000